My partner has zero interest in coding and wants to have a baby, a week ago she started to yell install baby at me. Told her its not the right command. A few days ago she yelled apt-get install baby. Told her there was a user privilege problem. Today she came back with sudo apt-get install baby.

looks like we are going to have to have a baby!

Today at work, still laugh thinking back to it!

We were on lunch break but the linux support engineers who are on the phones as well have to pick up calls anyways (very small team).

*engineer walks to the table, sits down: Ahhh rest, finally!*
*tringggggggggg*
*engineer pulls a face like 'oh for fucks sake' and walks back to his desk*
*puts headphones on and clicks the answer button just as it disappears*
"really!?! Alright lets finally eat now"
*sits for literally one second*
*tringgggggggggg*
*Engineer seems quite pissed off now. walks to his desk again, puts on headset, clicks the answer button JUST as the call stops again*
"Mother of god, fucking really?"
*stays as his desk for a minute or so, walks back, stays hovering above his chair for a little and finally sits down again*
"Finall......"
*TRINGGGGGGGGGGGG*
"MOTHERFUCKER. THESE GUYS TIME IT OR SOMETHING!?!?"
*walks back to his desk very frustrated this time*
*puts on headphones very quickly and presses the answer button*
*answer works but the call is literally dropped the second he starts it (it was a real client)*

"OH FOR FUCKS FUCKING FUCKING FUCKING SAKE FUUUUUUUUUUUUUUUUUUUUUUCK"

*walks back to table again and sits down. Takes sandwich and....*

*TRINGGGGGGGGGG MOTHERFUCKER*

"FUCKING COCKSUKING MOTHERFUCKING PIECES OF WHAT THE FUCKING FUCK EVER"

*gives a deadly look to another engineer: "I am NOT going to take it this time! En-fucking-joy."*

We laughed so hard xD

HR sent around updated contracts asking everyone to sign them since the company changed its name, fair enough.

In the contract it stated "Your normal place of work will be X" - only X was many miles away, and I'd never worked there, never planned too. Assumed it was a mistake, sent it back. HR refused to change it, stating that the "normal place of work does not need to be the place where you normally work."

A lot of back and forth entailed, I refused to sign, I was reprimanded for not doing so, I was asked what my problem was as it made no material difference, and then I eventually replied with:

"Angela, I'm refusing to sign this as it's factually incorrect. No further explanation is required. I'll maybe consider signing this if you sign a piece of paper declaring you believe the moon is made of cheese, and you're the cow the milk came from to make it."

A very strongly worded email came back about how this was going on my record, I needed to offer a formal apology, etc. - all cc'd to my manager. I replied back, again copying my manager in, stating that this was ok, as I couldn't remain at a company who forced employees to sign dodgy contracts anyway.

Problem was (for them), I was a *massive* single point of failure for them at this point owing to some others leaving with no handover - hence I knew I wasn't going to be the casualty here. My manager flipped the lid at HR, got the CEO involved on threat of *him* leaving, and the whole thing massively blew up. Happy ending in that the HR person in question was fired, everyone else's contracts also had to be redone (I assumed everyone else just signed without looking which is worrying), and I actually got a pay rise out of it when higher ups realised the massive single point of failure I was.

But damn, I would've walked over crap like that. Walked pretty soon after anyway!

[Thursday afternoon on a call...]

Client: Before we get started, can you create a sitescape outlining all of the pages and sections of the new website?

Me: Sure! I'll go through the website and shoot you a full layout in xls format as soon as possible, that way you can easily make notes on what you want added, modified or removed.

[Two hours later...]

Client: Hey, did you build that sitescape yet?

Me: Actually, I've been on back-to-back calls with other clients.

Client: So when are you going to get it done?

Me: Well, I have to go through the current website in it's entirety, which I'm guessing is about 1,000 pages. I have to determine which pages work fine on their own, which need to be combined for better presentation and which should be removed due to redundancy. That's something that is tedious and takes some time to complete. That, in combination with having an existing work queue that I need to fit you within and being at the end of the work week, we're looking at Tuesday morning to have it ready.

Client: "Existing work queue"? This is ridiculous. We're paying you good money to make our project your only priority. If we wanted to wait days for work, we would have saved money and paid for a cheaper service. You're already gouging us as it is! If we don't get the sitescape by end of day Friday, we're going with another company.

Me: I would tell you that I'm sorry for the inconvenience, but I'm not. I'm not going to feed you a line to make you happy. I'm also not going to work on my days off just to rush something out to you. You hired us because you wanted things done right, not quickly. Your current website is the result of not focusing on quality, but by how fast you can deliver it. We don't work that way. We only build quality products.

By rushing your project, not only do we alienate our current clients, affecting our reputation, but we build product of less than the highest quality. That will upset you because it isn't perfect, and it reflects poorly on us to use it in our portfolio.

If you want to hire someone to pump out this project to your unrealistic deadlines, be our guest. But you paid a 50% non-refundable deposit, so not only will you lose money, but your end product will suffer.

I'm going to let you sleep on this. If you decide tomorrow that another direction is the way to go, we wish you luck. But please understand that if we conclude our business, we will no longer make ourselves available for your needs.

Please find the attached contracts you have signed, acknowledging the non-refundable deposit, as well as the project timeline and scope, of which a "sitescape" was never originally mentioned or blocked out for time.

I hope that tomorrow we can move forward in a more professional manner.

[Next morning...]

Client: My apologies for yesterday. We're just very anxious to get this started.

-----

Don't let clients push you around. Make them sign a contract and enforce it whenever necessary.

Wasn't there myself. Came back after weekend or being sick or something and after the daily stand-up one of the guys came to me:
"hey man not to be rude or anything but we're not going to use your code for the project. You're programming in a wrong way."

They explained me where I was going wrong and then it appeared that my study taught me some principles of PHP programming wrong.

I felt like shit, downish and had to fight the tears because I felt quite humiliated.

Looking back at it, they were completely right.

A client called today because their email wasn't arriving at the receipants inbox but bouncing back with a 'poor MTA rating' error.

Checked about every blacklist I know and our server was definitely not blacklisted. Must be the receipants host which for some reason was blacklisting his specific email address.

Told the client that it wasn't a problem on our side and that he had to request a whitelist himself (we'd do it but it wasn't a specific server problem so we're not going to spend time on that).

Fair enough, he'd do that.

Calls back. "Well, the other party says that your server definitely has a poor rating, it's on your side!!"

Alright, this is getting annoying. Gave him a few blacklist checking sites links and told him to run his domain AND our server IP through it. Indeed came back completely clean.

"But the other party said it's poor rating on your side so I'd think tha........"

YEAH WHY DON'T YOU SHOVE THAT OTHER PARTY UP YOUR FUCKING ASS. I'VE SHOWN YOU PROOF THAT IT'S DEFINITELY NOT ON OUR FUCKING SIDE, EXPLAINED IT TO YOU AND SO ON. MAYBE, FOR ONE FUCKING SECOND, TAKE INTO CONSIDERATION THAT THE OTHER PARTY IS FUCKING LYING?!?!?

FUCK OFF.

There is no shame in using google to program.

'Back in the day' we had phonebook sized books of documentation on our desks we would reference constantly.

Why?

No one is going to memorize a phone book sized book. Not to mention three or four of them.

Being a good dev is about creativity, not memorization.

One of my colleague took 3 week vacation leave. End of vacation time he requested for extending the leave. Company is not allowed him, so he send resignation email. After 1year we get to know in vacation time he already joined new company. I asked him why, he said "That three weeks is trials. If nothing workout he planned to going back to old company." 🤨

Our company got attacked last month by what i believe was a code time bomb from a ex employee. And it was brutal, website hacked, email server not responding, locked out from database servers. The IT department asked for my help and I was more than happy to do it. Long story short I got every thing back working smoothly. The IT guys ask for a favor to not include this in my monthly progress report. Fine by me. But then they went out and tokd the top management that they are teaching me about the networks and servers so thats why I was working with them last month. Fucking assholes. Not going to help them any more.

USER: I can't see any data in the page...!
ME: ok, I'll do a check
ME: API calls get no data back. Boss, did you change anything and put it in production?
BOSS: Absolutely not, I just modified the name of what was the "Family" parameter in "Type".
ME: Seems legit. Totally agree. I'm going to lunch. Can you check in the meanwhile why calling the API with "Family" does return nothing? Thanks.

Phone not shipped out for nearly two FUCKING months.

Messaged the seller a few times, hardly any response and always 'very sorry ship soon'

Just threatened to cancel the order and get my money back.

Got a 'item has been shipped' two FUCKING minutes later.

MOTHERFUCKER YOU ARE GOING TO GET THE MOST SHIT REVIEW EVER.

PLEASE START TAKING YOUR RESPONSIBILITIES.

FUCKING FUCK YOU.

Sister comes into my room

"Can you look at moms laptop, it stopped working I'm scared I broke it"

Ask why

"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"

Top kek

Take a look

"EFI IPV4 0 (error code) failed to boot"

Weird. Enter bios

"Hard drive: [Not detected]"

Well, that's no bueno

Pop open back, hard drive is loose

Pfft, push that fucker back in

Boot -> works

"Mom is going to kill me I broke it im so worried" -> relieved laughter

Adobeflashplayerkilledmyharddrive.jpg

Shook.exe

I wrote (or, ended up with a very much alpha but usable version) a monitoring system a while back and completely forgot about its existence.

But, it's still running and a few days ago I was building a docker imagine on a system with not that many resources and after about 5 minutes I started getting notifications about a high load!

Then, while I had forgotten about it again, yesterday, I suddenly started getting notifications about websites on my main application server going down.
Logged in and all was good again after restarting nginx.

Gotta say that it feels quite awesome to be notified of shit going wrong by something I wrote myself while I forgot about its existence 😊

Collegue *yells through the office*:
Hey IT-guy the file is not there, where is it ?

Me: what file is not where ?

Collegue: you know that file i've been searching for 30 mins now on the Google drive.

Me: Have you tried hitting the name into the search bar ?

Collegue: Sure dude, I'm not stupid.

Me -> *one the way to her desk*
Collegue: OH! never mind I found it with the search bar. I swear it hasn't been there before!

*turning around, going back to my desk*
-fml

Client sends an email after 5 PM. We all left for home.

Client: blah blah blah...We urgently need this app to be done by COB on Monday. Our CEO is going to launching it on Tuesday to the board of Directors.

––Boss forwards me the email––

Boss: Can you get this done by this weekend.

––On Viber––
Boss: I have sent you an urgent email. Let me know.

––My Reply––
Me: This can't be done in a day or 2. Looking at the scope of work, I need at least 8 weeks.

––Boss Replies back––
Boss: You are not performing at the best of your ability. Come and see me on Monday, I need to talk to you about your performance on urgent projects.

Got very little sleep last night, not in a great mood to begin with. Came into work to find someone borrowed one of my cables that I need and hasn't returned it. It was wrapped around a few things to keep it tidy, all of which have been moved, stretched, bent etc. Now my battery is running low and he has emailed to say won't be in for 30 minutes.

Think the only reasonable course of action in a just world, is for me to strangle him with the cable when he gets in. I mean come on, whats the alternative? Still haven't gotten that pen back from last year ... this place is going downhill fast!

1. Submit my resume, get an email asking to schedule an interview
2. Schedule the interview
3. One day before the scheduled time, I get an email saying that the interview is being rescheduled to another time two days later (no explanation for why they did this)
4. I clear out my schedule and wait for the interview call (it’s suppose to be at 2:30, but I wait like 15 minutes early because I don’t want to miss it)
5. I don’t get a call
6. At 3:00, I call the company and ask whats going on. They apologize and say my interviewer will call me back as soon as he gets back from lunch.
7. He doesn’t call.
8. At 4:00 I call them back. Apparently the guy who was suppose to interview me went home. I ask them wtf they are doing and if this is how they treat their employees. They said they would reschedule the interview and call me back once they did.
9. No one calls.
10. I wait a week, call them back, and am told that the funding for my position didn’t come through (what does that mean? You’re not hiring programmers to design the software for your billion dollar war machines anymore? Seriously?).

I’ve had it with this company. I don’t know if it was just this incompetent recruiting group or if this is a company full of scumbags, but I mean, really?

Everyone generally agrees code reviews are a good idea right? And some form of testing is kinda a requirement before releasing.

Nope not my boss at the moment. None of my work has been checked in any way but is going out to thousands of users.

If I take the heat for bugs I'm gonna hit back so hard

PM : Have you finished the login issues?
Me, junior dev: No mister.
PM: Why not? You're going to delay the sprint.
Me: The other PM told me not to do it.

When you're the only dev in a project with two managers, life suddenly feels like you're back to 5 years old with your parents arguing all the time.

Me: I have been doing really similar tasks I'm going to spend some time making a template for it.

Supervisor: ok just don't spend to much time on it we have a lot to do.

Me: shouldn't take too long

1 hour later.

Supervisor : how's the work going.

Me: almost done with the template.

Supervisor: this is taking you way to long I need you to just get back to work.

Me: ok

He leaves and I continue work on the template.

30 mins later.

Show him the template.

Me: I cut my time on this specific task by 80%

Supervisor: good job glad I knew you should do it.

WTF YOU WERE TELLING ME NOT TO.

Generic-IT
--------------
Client:"So we would like to found a new company and offer IT and network consulting. Would you be able to build our website?"

Me:"Absolutely. What will be the name of your company?"

Client:"The name is going to be 'Generic-IT'. The website is going to be 'generic-IT.com' . We checked that with google."

Me:"I am sorry to tell you that generic.com is already taken by another company. Incidentally that company offers the same services, that you intend to offer. They also seem to be quite big an have businesses in 5 different countries.
Because of this I advise you to pick a different name that does not get you into trouble and makes positioning your own brand easier."

Client:"We want to neglect that problem for now."

Me:"0.0 ..... -_-""""
"Well, listen. Apart from the possible branding and copyright problems imagine how people will find you on the web. ...What will happen if you google 'generic IT'?"

Client:"Yeah well, we want to neglect that. And with SEO you can do something about that."

Me:"..........Welllll, you that SEO is not a cure all, right? The older an bigger company will come up first. Why not avoid that missunderstanding and come up with a unique name?"

Client:"......"

Me:"Please tell me. Doesn't any part of my argument make sense to you?"

Client:"..."

Me:"Well, ok. I will send you the estimate on monday."

___________

Then over a back channel I hear that the client is ...bewildered, why I would not stick to my area of expertise.

There I was now. Left bewildered myself, being the one with the webagency that does frontend design and branding.

Paypal Rant #2

Paypal might just be the only company with 98% of their employees being support staff because not a soul on this planet knows how to work with that fucking piece of shit of a company's service.

No really, if there was a shittiness-rating from 1-10 (10 = worst) you would have to store paypal's rating as a string or invent a new data type because no CPU could fucking work with such a big ass fucking number.

If I had to choose between Paypal and going back to manually trading physical goods/animals for stuff I would gladly choose the latter, because Paypal, go suck a bag of dicks you useless fucking shitpile of a "company".

!dev

I am such an idiot. I met this girl today (this is so so incredibly rare) and we got off to a nice start. We had things in common and our conversation was going quite well. She mentioned she was going for a walk in the park and told me I was welcome to join. And me... the idiot.. I had no plans for the evening... absolutely nothing else to do.... I told her I had to go catch up on some work and maybe another time and I just up and left with a “Bye”.. with a stupid smile on my stupid face.

Some history: I had a horrible break-up a while back and since then, I’ve been having difficulties meeting people.. let alone have a relationship. I started freaking out at the mere thought of getting close to someone. I keep thinking about how to keep people away and not get too close to anyone (not physically).

!rant
I must be dreaming .... Honestly! I am with a client that knows what he wants and has no problem to express it in clear words. They understand my tech talk and talk back in tech as well. We are on the same page regarding best practises. They envy my work and have really good ideas and express constructive criticism. What is going on here? I must be in a parallel universe or something?
Okay, one downside... Coffee is not free but a cup is 20ct, which is quite alright imho anyway. Oh, the even bigger downside... Things have been so constructive that my time there is almost over since shit got actually done in the most efficient way ever!

My first semester in college I had a six-week Saturday course on how to use UNIX that ran from 9-12. The professor hada habit of going at least an hour over time each week, so by the fourth week we're getting a bit tired of it.

That particular session, right at noon, he decided to teach us how to message other people on the network. Finally, we made our way over to the wall command a half hour later. Bored to tears, I type the following into my console:

wall "Are we done yet?"

Suddenly, the projector updates:

Kaji says:
"Are we done yet?"

Not realizing my name was going to be attached to it, I sank back into my seat a bit. The professor glared at me for about 5 seconds, then promptly wrapped up. Future class sessions ended on time.

So I'm on stack overflow trying to give back to the community that has helped me so much yanno.

So I see a question and decide to answer it but I'm on my mobile and trying to write a well formatted etc. answer is a bit tricky so instead I thought I would answer it as best I could on the phone so at least the OP would be going in the right direction and then when I got back to my computer, I would expand on the answer.

But before I had a chance (within 10 minutes of answering) some 200k+ rep dickhead decided it was his job to tell me how bad I was for not giving a proper answer and i have enough rep to comment and I should know better.

So I responded to him (my first mistake) and told him that my answer was intended to get him going and most likely he wouldn't need any more help but that I was going to update it when I got back to my computer.

Well he didn't like that and continued to berate me for my unbelievable behavior.

I then said that if he was that upset, then report me, or even better how about he actually answer the question instead of being a fuckwit to others that have tried.

I also said that I thought that SO and development in general was not about being given the answer but by finding it yourself and actually learning something and that sometimes you need to be pushed it the right direction to find the answer which is what I did here.

Well he disagreed with that too and downvoted my answer which by that point had been updated (like I said I would).

I just don't get it, what is wrong with these people and why has SO become such a toxic place?

I want to give back to the community and help others like people have done for me over the years, but then fuckheads like this just ruin it and make you not want to be a part of it anymore.

Then I come here to devRant and everyone is so nice to each other, you can see the respect.

FKING. LANDLORD. FKING LANDLORD THINKS MY LAN CABLE SLOWS THE FKING INTERNET BACK TO THE 1990s.

- Prologue
I'm renting at a place that looks good af. But the fking wifi is so slow, 80% of the time you can't even send an empty http request.

- Chapter 1
Okay, maybe it's my laptop. *plugs in cable*. Now the requests fail 10% of the time. Better than nothing. 2 hours later, gets a text saying other housemates are having slow internet because of me. FUCK. Unplugs, LAN cable, uses mobile data and cries to sleep.

- Chapter 2
Tries again after a few days. Barely uses the internet (I'm only using it to play games, not even download it and I used more than this with a 2mbps internet). No videos, no music, just small data exchange with a low ping. GETS A FKING TEXT AGAIN

- CHAPTER 3
My sis comes over and complains that the net is slow af. Plugs in LAN cable while no one is around, everything is fine. Sis leaves, I roll up my end of the LAN cable in my room but leave the cable plugged in on the outside of the room. Next morning, it's unplugged. Plugged it back in before I go to work and when I come back, guess what? ITS FKING UNPLUGGED. AGAIN. AND IM NOT EVEN USING IT.

SOMEONE PLEASE STOP ME FROM GOING ON A RAMPAGE SHOVING THE FKING CABLE AND THE ROUTER UP PEOPLE'S ASSES. LAN FUCKING CABLES DONT SLOW THE INTERNET BACK TO THE PREVIOUS CENTURY. ESPECIALLY WHEN THEY'RE NOT EVEN PLUGGED IN ON THE OTHER SIDE. FUCK.

So I resigned. After a long and torturing 1 year at my current company, I decided to leave. I wish I would made that decision in first four months.

The company is full of problems. I will explain them as much as I can in following rants. But I can name all of the stupid and dumb things I have seen here people do. If i was writer, I would wrote a book - titled as "which companies not to join EVER". But I am not a writer.

Overall the company was being ran by bunch of idiots. They did not have any experience with product development. But they like to micro manage everything.

I have seen death of agile and then it came back as a evil zombie named "micromanagment".

I am so glad, I am going to be free of all these things in few days. I can't wait to show them middle finger.

The whole devteam entering the meeting sitting there for a few minutes realizing the one who placed the meeting was not there. With questionmarks almost painted to our forheads we silently agreed on leaving and going back to what we did before the meeting.

Why can’t motherfuckers look where they’re going?

Went to the petrol station to put some more air in my tyres.

Some old dude was reversing out of a parking spot and had turned left so was now reversing along th back of the other parked cars.

I pulled into the car park, saw Home reversing and stopped, he was well clear of other cars, but he kept going back, I gave a little toot toot of the horn, but he decided to keep going and hit me.

It’s not the end of the world, and his insurance will cover it, but it will knack my no claims bonus.

Fucking Sunday’s, I shit ‘em

A few days after deploying a big important Website into production, I wanted to copy the whole thing including DB back onto our test server for future testing/bug fixing if something comes up. (Last changes were done on production server before going live)
So I opened SSH, removed everything on the test sever aaaaand then I realized I was connected to production...
Took about an hour to get everything up and running again. We didn't tell the client and hoped it would not be noticed.

not sure if this counts, but i'm sure it's going to hugely amuse at least a few people.

... sometimes when i get stuck in a coding task (when i'm working at home, of course) i go watch porn for a while, it clears my head nicely.

there was one day i was trying streaming my programming for the first or second time in my life, and... yeah, i got stuck. and yeah, i forgot i was streaming...

luckily, nobody was watching those streams, and i realized what i did as soon as i got back to coding, so i immediately stopped the stream and went and deleted the vod.

i think the next time i mustered enough courage to try streaming again was like two or three months later... XD

rant¡

Client: "Can you add some logos to the homepage?"
Me: "Sure, I've just added it, take a look at staging."
Client: "Great, we can move it to live"

** 5 days later after it being moved to live and telling them I'm going on holiday. **

Client: "EMERGENCY change logo now, we need to change x logo. These logos look crappy too. How did this happen?"

Fuck this. I'm not employed by you, you don't have any right to speak to me like that. Especially after working tirelessly for your company.

**sent email back explaining how to upload files**

Told them not to contact me unless it's technically related.

When I left university I got a Graduate Developer role at a local start-up. For the first year there i did html and css, second year I was in the support team.

Not a problem because sometimes you have to eat some shit to get where you want to be. But third year I got moved into the Dev team properly.

A month in, the Support team, without someone with a devs brain and a "devs" knowledge of the product, started falling really far behind and struggling and the MD told me I'd be going back into Support for another 6-12 months. So I told him to fuck off, and if he did I'd just leave. They never did and I stayed. 👍

Had a job interview back where I want to move(2300 miles away), doing exactly what I wanted. Unfortunately it was for a senior developer, a bit over my pay grade.

First Interview: "It is above your skill level, but I like you. We will make it fit you."

Second Interview(technical): " You did super well! I will make sure to pass the good news onto the boss! I am excited to work with you soon!"

Response to my thank you email: "We decided to not persue you further for this position. We are going with someone who has more experience."

Why string me along?!?!

Most unprofessional experience at work?

<about an hour ago> Went into the bathroom to do the morning deuce and there was crap all over the back of the seat. WTF!? Did you miss!? In our part of the building its only devs and network admins, so again, dudes, WTF!?

Oh, and never spit your gum out in the urinal. Its not a new, fun target for you to shoot at. *Somebody* is going to have to pick that nasty thing out. Our maintenance guys have hard enough job than cleaning up after 'so called' professionals.

Some time ago I quit my job at a big corporation. Getting treated like a resource, a production line robot, just isn't for me.

My current job is way better. Small company, lots of freedom, getting to work on multiple projects, the result counts. But, as a small company, we also collaborate with big corporations. So I joined a team at one.

Watching my coworkers there, I'm reminded of robots again. Lunch break? 15 minutes tops. Just shovel some edibles into your face hole and back to work. Five minutes break between meetings? Open laptop, work work work. The concept of "needing rest" seems entirely foreign to them.

Yesterday our product owner "relayed some criticism" from other team members to me. Apparently, me going to the toilet in breaks is "suddenly disappearing". Or me not replying within 15 minutes in the chat is outrageous. And then he tried to berate me how I'm "his developer" and his team's tasks have top priority. So, according to the PO the problem is me and I should "get used to their mode of operation".

How about "no". I quit a fucking job because that "mode" is simply inhuman. After that feedback, you bet I'm taking my legally protected 30 minutes lunch break and any other break I can. Because fuck yourself, you're not going to burn me out. The best part, that team has smokers who "suddenly disappear" twice as much as I do, but apparently that's somehow a-ok.

I had to remind him that his project is just one of several I'm working on, so no, not "his dev". While that wasn't exactly a powerful comeback, it did shut him up. Still going to talk to my boss on Monday, at least to ensure that the PO can't talk shit about me behind my back.

Observation:
Today I was drinking coffee in McDonald's located in Poland. All people in restaurant were using smartphone even when they were not alone. A lot of people are leaving McDonald's still watching on smartphone screen without any care about surroundings and their safety. Only me and homeless guy sitting drunk in the corner wasn't looking at smartphone. It scares me how fast people achieved some kind of addiction to all this apps in smartphones :o

Few days ago I saw news that one teenager got lost during going back from school because he couldn't use smartphone to navigate with GPS xD

Microsoft are getting a lot of pats on the back today for open sourcing MS-DOS. It might have meant something before FreeDOS was so well established and mature, but now... really, who gives a shit? Even more significant, they already "open sourced" it before, just not hosted on GitHub.

Here's the thing. Going open source is like losing your virginity. You only get to do it once, you can't take it back, and you certainly can't claim to be doing it again just because you're using a different host.

I always find it more productive to have at least two ongoing projects at once.

That way, if I get stuck on a bug/frustrated with the first project, I focus on the second and more often than not, when I go back to the first project I realize that I had made a dumb mistake and keep going.

I finished two projects. Both of them need to connect to each other. However, the tool to do that is not currently licensed to achieve my desired outcome. I email my boss to check the status of the license key I need, that they promised, and the only thing I get back is "Correct." Seriously? 😠 The person who has the company credit card and authority to buy, also the same one that gives me a deadline to turn this shit in, can't give me the time of day to respond to an email? Their response wasn't even relevant. I've been trying to move beyond this roadblock for a week now! I'm a pretty independent guy, but I'm not going to buy the license myself for a tool that I didn't even want to use. So when someone comes to my cube and I'm raging on Steam, ✋ I don't want to hear anything about company time, because mine isn't being respected either. 👊👊

Customer: (calls emergency hotline) We have a really bad bug!
Rep: What seams to be the issue?
Customer: I need to talk to Sam, he knows what to do, tell him it's urgent.
Rep: can I tell Sam what the issue is?
Customer: Well, Sam built a newsletter program but I don't have a way to import mass amounts of emails addresses.
Rep: That sounds like a feature, not a problem.
Customer: why wouldn't it do that? Would you build a car without a steering wheel?
Rep: I am not sure that's relevant to the problem.
Customer: what do you mean?
Rep: I would say it is more like, "would you build a car without a pair of jet skis attached to the back." And we would respond with, "we would be happy to add Jet Skis, but it's going to cost you additional money."
Customer: So, how are we going to fix this bug in YOUR software?
Rep: :/

My work laptop (windows) updated yesterday. Today my monitors keep flickering, hanging, and going black for a few seconds then come back with an error that my display drivers crashed. Since I have basically zero access to anything admin on this machine, I put in a help desk ticket with all the details, the error message, even screen shots which took forever to get because of all the crashes.

They finally respond after about an hour, and tell me that my computer does not support 3 screens so I will have to use 2, and that is what is causing the crash. Well I have been using 3 screens with this computer since I started there in 2014, and it has worked perfectly until the update, so I asked if they could revert the update.

He told me that they could not revert it, and not only that, but I couldn't have been using 3 monitors before because the computer doesn't support it and never has. REALLY??? I just freaking told you I have been doing that for over 3 years so obviously it does support it you deaf, stupid retard. Try using your brain for 2 seconds and work on a solution instead of calling me a liar and dismissing my issue without thought.

After going back and forth for about 5 minutes I gave up and hung up. Finally I fixed it by switching out my docking station with another one I found laying around. Not sure why that worked, but I'm back to working on all 3 monitors. I called the guy back to tell him it's working and sent a picture of my setup, his response: "Well I don't know why that works because your laptop is too old to support that."

Useless...

!dev

To anyone suffering from chronic pain, especially lower back pain: Don't get fooled by shitty doctors. And don't expect doctors to magically heal you. If you want to stop your suffering, you need to be proactive.

What? But my herniated disc from 10 years ago... bla bla bla. So what? It's not going to get better when your only exercise is putting on your socks. Chances are 99% that your spine has shit to do with your pain. Go to a proper chronic pain therapy instead of downing opiods and getting sick notes.

Note to self: Do your sports every day you lazy bastard. Eat healthy, sleep regularly, don't stress out over every damn thing and don't forget to fucking relax!

PM: Ok Android, i've reviewed the latest build, you are good to release. Waiting on iOS's build to test.

Me: ... are we not holding all builds until we hear back from backend about that bug?, as we likely have to change something on our side?

PM: Which bug?

Me: ... the only one we discussed yesterday in the team meeting.

PM: How many customers is it affecting?

Me: that we know of, one ... the CEO of our company

PM: oh that one, yeah were not doing that anymore.

Me: WHAT? i've been waiting all day / night to hear back. Why are we not doing this?

PM: ¯\_(ツ)_/¯ ... Everything is too messy at the minute anyway, the release plan is changing every day. Need to keep it back in line.

Me: ... the plan has changed exactly once. We had a plan at the start of last week for the last release, we changed it YESTERDAY to include 2 critical bug fixes. The only issue with the plan changing is nobody telling us these aren't bugs anymore

PM: We can discuss tomorrow in the team meeting.

CEO: oh hey guys, yeah we pulled that bug fix. Its not really a bug, more like a missing feature. No way it will get done before xmas. Going to live with the way it works for now and fix it properly next year.

Me: Ok, fair enough, but we really need to be told these decisions.

CEO: sure, sorry, didn't think anyone was blocked by this. What was the blocker?

Me: ..... you asked me yesterday to get this bug fix in the build ... you asked for the final build to be made today so we can go through the app store review. As we all discussed yesterday, today is kind of the last day we can really do this.

CEO: ok, its late, we can discuss this tomorrow in the team meeting.

Me: ..... ..... ..... ..... sure

So i've spent the day:

a) Finding evidence (again) of product not doing their job, to send on to one of my managers. So we can again discuss why she's still here.

b) Explaining to my iOS developer that although all the devs are in agreement that 2 of them are not pulling their weight and shouldn't be here ... they will definitely still be here because management actually want to keep our multi-timezone setup as they see it as beneficial. We, do not.

c) Having a meeting with another manager, in a different department. (Backstory, a member of their team has had many complaints filed against them by various members of the building, including one from my team). To let them know that my employee felt like you ignored her concerns and complaints and are going to allow this person pass their probation without considering the implications.

I hope to actually find some time in the reminder of the day to actually achieve something, rather than just telling skidmarks that they are in fact skidmarks.

... but probably won't due to 3 hours of pointless back to back meetings, where we answer the same few questions every week.

I really do love being a tech lead. So refreshing.

Whatever you do, just keep going.

If you don't have mental capacity to do all tasks today, do one or two. If you want to do that side project you wanted, but lost motivation in the moment, do at least something, like a sign up form. Just keep going. Put some work in, make this day's net impact positive. And it's not all about work! Wanted to play that game you bought on a steam sale but never opened? Play the first level today. Wanted to learn how to make music? Download Ableton or Fruity Loops, watch a tutorial video on YouTube, replicate the steps. Just keep going.

Wandering directionless and letting yourself go is the sure path to misery. Remember — every figment of human behavior has a reason. It is important to identify reasons behind seemingly random behavior patterns and comprehend them in a non-judgmental way. Then, starve what holds you back, and feet what keeps you going.

I have bipolar type I + autism. Using this approach and remembering that everything has a reason helped me debug my low productivity. And no, I don't mean my job, I mean my real goals I want to pursue even if I had a billion in the bank today and never had to work a single day in my life.

Aaand, the reason was?… fear. I discovered I had PTSD all along that manifested when I was misdiagnosed and prescribed strong neuroleptics. In a way, it's a chemical lobotomy, just less invasive and more reversible. My intelligence came back, but it came back together with PTSD.
Now, instead of chasing mythical productivity, I know the reason behind the lack of it — PTSD. It is hard to fight what isn't defined, but it is real to win a fight with a thing with a name and a face.

Just keep going. That's my message to you.

You know what, fuck microshit to fuck town and back again.

What part of disabling "allow the computer to turn of this device to save power"

DO YOU NOT FUCKIJG UNDERSTAND!

MY FUCKING USB'S ARE GOING FUCKING MENTAL SWITCHING ON AND OFF LIKE A DRUNKEN HOBO YOU COCK FUCKS.

my week is a complete and utter shit of a week as it is, I don't need this bullshit on top of it too.

#Microsoft, fix your fucking shit already!

I cannot even begin to describe the rollercoaster of emotions I just went through. I'm on the train, the prompt says next station !my_station. By then the sign says my_station. So I rush off the train. I feel the lightness of a heavy weight lifted off my shoulders... And realise I'm missing my laptop bag, the heavy weight that should be on my shoulders. So I rush to the station office and describe everything about my bag and what's in it and the seat I was in. The guy can't get through to the conductor but the train will be back at this station in 30 minutes. I head home quickly because it's nearby and my fiance offers me a lift back to the station on her car. Suddenly we're running late. She's running red lights. I'm not going to make it. It's 2 minutes past arrival time. But the train is 3 minutes late! I'm running along the platform looking into the carriages for my bag but unable to see much, panicking. The platform is empty. The train. Is going to leave. Except for one lonely figure walking down with a bag in their hands. The conductor gives me my rucksack, tells me it's really heavy and heads back to his duties. I thank him and head back to the station office to thank the man on duty also. Fuck me that was scary.

TL; DR: please save me from IT hell

Note 1: this is a rant that comes after a couple other rants I'm going to call "family business saga" from now on because I feel like this is gonna go on for a while

Note 2: the following may look exaggerated but it's because of how pissed off I am at said person

So I have to help this one family member with his computer but he's worned me out so much last summer that I can't stand him (it's all tech based). At all. Both in person and via text calls. I dread and become pissy each time he's nearby, just his presence makes me want to jump in a hole and stay there for eternity.
And he's not the smartest cookie in the jar when it comes to tech, so he comes to me for help (instead of going to my brother. Aaagh why doesn't he go for my brother as well, it's mentally tiring having to "help" him - as he doesn't learn what I'm trying to teach him even after several attempts). I don't really mind being sought for help when it comes to tech, but this guy takes it one step further.
He entered my room with his computer in his hands saying this friend of his has installed W7 on his PC (why didn't he handle all the things he wants to do, it would save me a lot of anger containment) and that I *had* (it's always "YOU HAVE" because I'm a tech-ish person and I'm in uni for CS) to help him do a bunch of things.
So he boots up the thing and there are 32 updates to do, so I'm guessing that he didn't boot it up after the OS update until now. He leaves my room and I sigh out of relief. He comes back with the AC remote complaining it's too hot in my room and that he's gonna put it down a degree or 2. Jesus christ do not tamper with my AC settings, it's fine to me. The updates are still going on. He leaves again.
The computer takes its time to update and so does he. I'm happily playing minecraft when he comes back, the computer off after updating. He looks at it and says "why is it off?". I reply back "it finished updating.", trying to keep my cool. Even the most simple questions are irritation inducing.
He reboots it and lets it run. After it boots and it's ready to go he just stays there for like 2' without doing anything because the hard drive light was going off. I think he thinks the computer is going to explode if he touches it while the light is blinking 😬
He goes to connect the computer to the internet and gets all surprised that the computer doesn't recognize our home's internet (he has been here before with his computer, I guess, so he had connected, so I think he was expecting it to auto connect like that). I tell him that the computer doesn't recognize our home's connection because it has had a fresh OS installation and so it didn't have any connection registered. He types in the password and the connection is established.
He them starts going on about that he wants to get these pics on the business' website and how does he put them in his computer and all that. I do that for him and he's all like "how did you do that?? 😮" like it's a magic trick
And he's always going on at everything as if it's all a big undoable thing. "How do I do this? You know what, do it yourself and show me because I don't wanna fail". Dude. Bro. Everything - EVERYTHING - you are afraid of doing is undoable. EVERYTHING. Good christ.
I swear I've never felt so glad I'm going back for uni next week

New job was killing me. remote team has an 8 hour time difference to us, and no understanding of it. Constant last minute invites to meetings at 10pm my time. Made worse by the fact that many were unnecessary, duplicates or just plain pointless. So for the last few weeks of last year I made in my mission to clean it up.

New plan: move my hours around on Mondays, stay later, move all the meetings back to back and get everything out of the way for the rest of the week.

First day back and heres how the new plan is shaping out:

- 5:30pm meeting organiser decided we actually need 2 almost identical meetings instead. Sends out a big team meeting for the same time as my 1st meeting at 5pm, as well as the existing one for 5:30pm. Already agreed on by everyone else, so had to go.
- Cancelled my original 5pm meeting for today, said we'll re-arrange it for earlier going forward (not enough time for notice for remote team).
- Went into my new 5pm meeting, turns out we don't need 2. Got everything done by 5:30pm.
- Just to be safe though, a new invite will be sent around for the hour of 5 - 6 "Just in case".
- My 6pm meeting just got cancelled as she has a conflict (despite setting it up 2 months ago)
- Now I have to wait around, after hours for my 6:30 meeting.

..... believe it or not, this is progress.

Happy new year!

I spent four hours just getting my dev environment working again today.

Whenever I switch branches on this project, I keep to run a script that does migrations, seed data, test db setup, static test info, etc. etc. etc. It takes 12-15 minutes to run.

Today, that script failed.

Apparently one of its steps requires running some of the project's code to produce valid objects. Makes sense. However, my ticket involves breaking a crapton of models (removing accessors) which I've already done, and then patching the behavior, which I haven't. Which means a lot of things are currently broken. Makes sense why the script fails.

However, I can't run the script on a different branch and then switch back because that simply doesn't work (for reasons), so I needed to find some workaround. I eventually did, but every attempt cost me 12 minutes.

Today was not fun, and certainly not productive.

I wonder when they're going to fire me 😅

#prank

New guy on the team, learning WPF.
He forgot to lock his computer when fetching coffee. I added a transform group in the main window and checked it in to Git. Locked the computer.

He comes back, furious at his computer for turning the application upside down.

Next two hours he was rebooting, flipping the screen, stressing, googling until I finally had to confess.

He uttered a strange sound of short burst of laughter concealed in a relief of not going insane.

It was a good day.
His pull request was rejected.

I messed up. We have a senior executive that loves this phrase... "It's going to require all of us to make some sacrifices". 100% of the time he's talking about working 10, 12, or 14 hour days.

So after a few months of this I just chimed in with "this isn't church I don't give sacrifices to my employer. I get PAID for my work."

Honestly I can't say it slipped. I've been telling my wife the exact same phrase for a couple months now. Initially I wanted to discuss it with him directly. Maybe I could explain how making everyone work 14 hour days is not going to end well for us, short or long term. We already know the results short term. We got 50+ defects reported back in our first day of testing for a new project (I'm not on the project but we had a sort of "all hands on deck" meeting to talk about how we can "improve our process so that we don't make so many mistakes". I politely suggested move some people onto this project while we interview candidates. I volunteered to take some of the work items even. But that advice went ignored.

So that's why I asked to meet with the senior exec. He refused to even meet with me. Okay fine you're busy. I emailed him my concerns and suggested solutions. Never heard back. I knew he was going to pipe up with the sacrifice thing so I just blurted it out. It went ignored... So I guess we'll see if I have a job tomorrow or not.

Client: Hey can you get rid of the dark overlay on the image?
Me: It would make the white text unreadable on the images you use so it would not be advised

Day passes

Client: (literally resends the email even though he saw mine) Hey can you get rid of the dark overlay on the image?
Me: (changes it and tell my colleague he's 100% going to ask to change it back) changed it
Client: I made a mistake can you change it back
Me: To colleague, told ya 😂😂😂 🤓🤓

Oversleeping due to sleep-walking to my phone and turning the alarm off and going back to bed is a thing for me now. Fuck.

Is there an alarm clock where you have to type in different shell commands to complete a given task on Android in order to stop the alarm? If not, I'll have to do something with my Raspberry Pi...

Manager: "Hi Almond, how is X going?"

Almond: "...I don't know, Bob is in charge of that."

Manager: "Ok. Do you know the status of Y at all?"

Almond: "Not sure, isn't that Bob's responsibility too?"

Manager: "Well, yeah, but I never seem to be able to get a good answer out of him. Find out on both fronts and let me know ASAP please"

...sure, I know how this goes. I'll stop all the dev work I'm doing, do your job for you, talk to the lazy bonehead that never bothers doing anything, report back that he's done sod all (or still "in a requirements gathering phase" as he puts it), be asked "why is he taking so long", have a bit more back and forth, then decide we'll just leave him be as actually trying to get him to do any work is going to be too much like hassle 😒

Dear devranters,

Recently, i stopped liking the job that I used to love. not because i got bored of the work, but because of the company politics and drama.

All in all i feel very disrespected and treated as just a pawn to do whatever management feels like. I am tired of being promised things and management going back on them.

I have decided to try to make my own software company. as small as it would be. just anything where I am not anyone's slave or "employee". I want to be the boss for once... and not wait for someone to give me my salary and telling me to be thankful for it.

my main concern is gathering clients. If you can suggest a few ways in the comments id be grateful

1. Hit everything you do. You will learn more faster. Don't accept things at face value, care about why things work.

2. Study and experiment constantly. Be aware of your surroundings and what is going on. If you're not ready with a solution when a power vacuum appears, you will always be a grunt. Or worse, eventually a manager who everyone hates because you constantly tell the people who report to you how "back in your day," your code was amazing, there were no bugs and your shit doesn't stink.

3. Be honest with yourself: If you just want to keep your nose to the grindstone and make manager so you don't have to code anymore:

Quit. Stop now. Do not pass go, do not become a cancer on the industry.

Go get a job as a PM, you'll have a better career and you won't be the weak link holding everyone else back.

Tl;dr When the shit goes down, you better be ready.

recently people have been worried about what people were going to say I.e "no hate" , don't hold back!

In devrant we only mean light hearted banter if we are pissed we don't want to hurt you we are pissed at a thing and not directly at you. Not that I speak for dfox or trogus but I'm sure that's what they are going for, and it's what ive seen!

We are nice here... This isn't YouTube , it's a credit to devs we are nice people. Hell it isn't stack overflow!

Also I'm brutally honest at times but I love you really.

"When you’re a carpenter making a beautiful chest of drawers, you’re not going to use a piece of plywood on the back, even though it faces the wall and nobody will ever see it. You’ll know it’s there, so you’re going to use a beautiful piece of wood on the back. For you to sleep well at night, the aesthetic, the quality, has to be carried all the way through." - Steve Jobs

Seriously, Ubuntu can go burn in hell far as I care.

I've spent the better part of my morning attempting to set it up to run with the correct Nvidia drivers, Cuda and various other packages I need for my ML-Thesis.

After countless random freezes, updates,. Downgrades and god-knows-what, I'm going back to Windows 10 (yes, you read that right). It's not perfect but at least I don't have to battle with my laptop to get it running. The only thing which REALLY bothers me about it is the lack of GPU pass-through, meaning running local docker containers rely solely on the CPU. In itself not a huge issue if only I didn't NEED THE GOD DAMN GPU FOR THE TRAINING

Client : I am unable to download data from your sever for last 10 days.

Me : Sir, we are sorry to hear that. We are doing some maintenances on our server from this morning today. We request you to call back us in next 4 hours.

Client : But i am facing this problem for last 10 days.

Me: Sir, i heard you. As maintenance is going on it will not be possible to download data this time.

Client: From when this maintenance is going on?

Me: from this morning sir.

Client : but i am facing this probolem for last 10 days.

Me: Sir, you are not understanding it, or may be i am failing to describe the situation to you...

Client: Listen, you guys are incapable. Only knows to make excuse.

Me: Sir..

Client: Sorry to say, i am not Happy with your support. Let me talk to your senior tech guy.

Me : Sir, your problem will be solved in next 4 hours. We will call you as soon as our server went online.

Client: *.....*

It took me 20 minutes to finally make him understand the situation.

Client: Why did not you said that earlier? You guys will have all the time but i do not. Anyway.

He hangs the phone.

My ears are burning man...

Yknow what the best part about Unix is? (Not Linux. Like old school Unix. AIX, HPUX, or in this specific case: Solaris)

It never needs to be updated. like ever. Even when new features are added 5 years ago to add features that GNU has had for literally decades. Updates are for the weak. Because why should I be able to type "netstat -natup" when instead you can enjoy several hours of developing the nightmare one-liner that is:

Pfiles /proc/* | awk '/^[0-9]/ {p=$0} /port/ {printf "%.4s %-30s %-8s %s\n", $1,$3,$5,p}' 2>/dev/null

Isn't that just so much more fun?!
Thanks guys. I'm going back to GNU now if you don't mind.

I was noticing some slow network and it was dropping some connections. So I booted up my old XP install with Java 6 so connect to the ASA 5505, I see it’s logging max connections of 10000 has been reached.

Fine, I recon it’s my colleague backing up his entire machine to Google Drive.
Because when he shut it off, n connections dropped.

I check back in the log, and I see there’s 4-500 connections happening per second, I think WTF and check the source IP. Lots of random IPs from Vietnam, all going to a Windows2008 Server using rdp.

(I didn’t setup our servers, so I didn’t know which server it was accessing)

Ask my other colleague, he told me it’s a windows server from an earlier project that’s not used anymore.
I rdp into it, see there’s users logged in from around the world, and I immediately do a shutdown.

Would you look at that, connections per second dropped to about 50.
I guess that server isn’t going back online ever.
And I now need to ask management for a budget to update our network infrastructure, because the old ASA 5505 is begging me to die.

TL;DR gg previous employees didn’t shut down old servers and left them open to the world to enjoy

a message to code.org

- the fact that you have celebrities back your organization does not mean your content is good

- making highschoolers (>14 years old) ask yes or no questions for a week is NOT helping them 'understand' binary, ITS JUST FUCKING DEGRADING

- all of your curriculum is useless. fucking useless. you're and 'organization' dedicated to getting children into programming. SO WHY THE FUCK DO YOU GO OUT OF YOUR WAY TO MAKE EVERYTHING WE'RE TAUGHT USELESS. the app lab is js but NOT ON A WEBPAGE, it just instructions for a fucking character that you paid shit loads of money to, and not to mention slower than my commodore 64 mining a bitcoin. if I'm going to learn js, I want to make a webpage. how many fucking js recruiters are going to ask if you can make an app code.org's app lab??? fucking none. if we're going to learn how pictures are encoded, CAN WE ENCODE A FUCKING PICTURE? jpg, png, bmp, I DON'T CARE. but the fact that we have to set a delimeter and then type a 64x64 image in binary makes me want to die, but it's also USELESS.

- in the entire networking unit, they focused more on their goddamn animations over their actual EXPLANATIONS

Dropped by my old uni to visit some friends. Met an old classmate who wanted to ask me something about his Python code.

"Oh, no", I thought to myself. "I haven't touched Python in so long, I don't know if I can help, and even then I only knew how to do menial tasks in it!", thinking how to save face and my image of "programmer dropout".

5 minutes later I realized he was mistaking a dictionary for a JSON string, AND was trying to access a dictionary in a list... in a dictionary.

I quietly fixed his print statement which incited an excitement "oh wow, it works!" and quietly returned his laptop. Fun day.

Time for some stats gathering! What mobile phone are DevRanters currently using? I've recently switched from iPhone 5 to Nexus 5X and I can surely say I'm not going back 😁

Best part of being a dev? Rock star status when things are going well: had to get a fix out by 18:00, boss walks by as I'm watching something on YouTube and tells me the client called and wanted to be sure we'd have it done in time, told him not to worry and went back to my video. Pushed the fix at 17:30, and tomorrow I'll be in the same position: every last minute fix delivery only grows my reputation for getting critical last-minute fixes out in time... As skeptical as my boss was at the time when he walked past and saw me on YouTube he had to he polite because he knows how crucial I am to this project

I think tomorrow I'm going to work on my own project and slack off, no one will be able to tell me different

Tried to do a startup for a year, did not make loss but did not get the funding to keep going. Now going back to previous company and taking up the old job. 😔

I lost one of my idols, there are few people I have that much respect for. I literally can not think of anyone else infact.

Ive just been taking a second.🙁 I mean you live your life thinking there's time or that you can wait to do things , like I'll just do that one thing a little later. But it's not true. The reality is there's so little time.

There are few truly great people. It's going to take me a little while to get over it properly.

But when I do I hope I don't switch back into old patterns.

I want to be just like him, his work was amazing. He worked all the time not because of fame or money but because he just wanted to make cool shit for people to enjoy. Because he enjoyed it himself and he liked seeing people amazed and happy due to his work.

The best people are the types of people who bring a smile to your face by just being who they are.

It was enough to know he was out there doing his thing being that incredible, it never occured to me he could just be gone. The world needs more people like him especially now with everything so fucked up. He died far to young. 33 isn't old it's not even middle aged

All I want is to be like him, I hope I will be one day 😞 and I'm going to start trying right now.

And I will try harder.

> My company started posting things on LinkedIn. That's cool.
> My company started asking us to like and share said LinkedIn posts. Okay.
> Since I'm already on I decided to update my LinkedIn profile following some advice I've seen and including some key words. Coolio.
>> Now I keep getting recruiters wanting to be added to my network 🙄 not cool.
I've seen so many posts about recruiters being annoying on LinkedIn and never understood until now. I think I'm going to go back to having a crappy profile so these people don't find me

How useful was my CS Degree?

I don't have one. I went $50k in debt trying to get one, but after shuffling schools and trying to make it work around a full time job...I took a break.

I've been a professional developer for 4+ years and worked in IT for over a decade.

I'm not sure if it's worth going back, but it sucks to have all that debt and nothing tangible to show for it.

So, I'm trying to process the feelings from not getting accepted for the PhD project I applied for a while back. And it's just unfair. They've recruited people with no publication and less GPA than me. I also doubt any of them would be field-wise more relevant than me tbh. (Wouldn't be surprised if they hired MBA grads) I have all the relevant qualifications that even people working on that project do not have. I could easily get this project going beyond what they are doing with it rn. It's unfair. But it's life. And life goes on.

Am I angry? Yes. Am I disappointed, also yes. They didn't give me any alternative offers either. So I am going to steal the project and finish it so they have to throw all the money they've invested in the toilet.

... If only I wasn't depressed and could bring myself to apply elsewhere again. 🙄

!rant

TLDR; Lost passion after a few years, wasted a year, went on vacation without really any technology, found my passion and am excited as hell for 2019.

After programming for nearly 5 years, I’ve hit the point of not wanting to program anymore. I’ve burnt myself out, and haven’t had a vacation in 8+ years so we’ve finally decided to take one. I’m not going to say it’s a full blown vacation, but a semi-vacation since it’s with my parents also so I do have to do a few things I’d prefer not to such as meeting relatives.

I didn’t have the motivation to work on any new projects, finish any projects I actually enjoyed, I just did a few side projects for friends that took me anywhere from 5 minutes to 30 minutes every few weeks. In general this year has been garbage in development terms, I’ve lost passion. It felt like a chore, I didn’t find the entertainment I once did.

I’ve been away from technology for about 2 weeks now, and have less than a week left before I fly back and I’m excited as hell. During this break away from technology (with the exception of browsing devRant once in a while), has me excited to work on many projects and actually start learning and improving my skills. I’ve actually gained the motivation to work on 2 projects that have been planned for nearly 2 years now, I’ve noted down ideas for them, made diagrams, etc, just never had the passion to develop them. 2019 is going to be one hell of a year, since I get back almost at the end of November, and December I have a few business meetings and University exams that I have to prepare for. Excited to see these projects through, one is going to be for the hell of it, just been a passion project I’ve wanted to do for years now. The other project is actually a project for one of my sub-companies that hasn’t officially released since I didn’t have the passion to work on it. (Not going to go into full detail yet about the companies/projects, going to save that for the future)

Alongside that, I’m excited since my main company that is totally unrelated to technology, is set to do some massive moves during 2019 also. Looking forward to that, and being able to launch my dream company (the sub-company I mentioned before).

Time for sleep now, goodnight! (Wrote this after a few drinks and in the middle of the night, hopefully it’s not full blown garbage)

My boss is the head of IT.
I am the head of software, I have nothing todo with user rights in our software, this is head of IT things...

So my boss is gone, holiday.

User T calls in: Hey, I need rights for finance software X. Now.
Me: Yeah, my boss is gone for good, which rights exactly you need?
T: I don't know. Give me admin rights.
Me: I am not going to do that.
T: I will call my boss (head of her department, same level as my boss). He will tell you to do that.
Me: I will not listen to him, he don't decide about rights. IF you talk to the head of finance and he tells me you can have admin rights in the finance software, I could give it to you. Let him write a email to me about it.
T: Okay.

2 Minutes later.

Email, Head of finance: Hey Wasseratem, I don't decide for rights for the finance software X, normaly Head of IT does that.
(CC to T)
Email back: Yeah, he is gone, he will be back in 2 days, then he can decide.

Email from Head of Department of T: Give T admin rights. now.
Email back, CC Head of Department of T, Head of finance: No I will not do that (etc. explain why)

What the fck is T joking me?

Now She will not get any rights for thursday even when she will walk into my office with a gun.

A coworker asked me to give him a hand on a project last thursday at around 8:00pm, by Friday noon I had most of it complete. Then turn the code back to him. Then somehow , it got placed on me during the weekend....20 mins before leaving to San antonio to be with my sister while my niece was born. Yeah...no..sorry...guess who enjoyed SA this weekend? This guy. Past experiences have shown me that one should not sacrifice personal time for company bs. Specially here in south texas where the majority of employers are from Mexico. In Mexico, there is no worker appreciation culture, going above and beyond the line of duty to accomplish tasks is not met with any sort of consideration. So nope nope nope nope.

Sooooooo since a few days im feeling more and more depressed.

There are some things that might cause it :
- school
-My last frienhship broke (not like i care about sociality. lol)
-my parents being so strict.

What can i do except for going through this, eyes shut?
I alceady had a depression i dont wanna get back there :/

I think there is such a thing as "getting too comfortable with the people you work with".

My boss came over and wanted to show me how to do a new process. We start going through the steps and a question arises. I then IM my team lead, because he's the one who would know the answer, and all I get back from him is sarcastic comments and profanity (he doesn't know my boss is sitting at my comp with me). So I keep trying to get him to be serious, and he just keeps his mouth (well, fingers) going. (He is remote - not in our bldg). I want so badly to shut him up because what if he says something about my boss while she is sitting there? Not that he does that, but at the pace he's going, it no longer would surprise me.

There should be some sort of code to hint to your team to STFU and give a fucking answer when one is needed. Sort of like what kids do to hint that a parent is in the room, but for work?

Not goals. More like dream...

... To get into that one uni that I actually want for phd.

I have gotten so spoiled playing with robots and neural networks, that I can't even imagine falling that badly from grace to go back to... web development. Like I'm not looking down on it, it's just that I found my passion and there is not enough jobs available out there for me without going through phd or high-end research.

... And I honestly don't have a backup plan. There are choices, but I don't like any of them. So here goes hoping they accept me. ¯\_(ツ)_/¯

Had a mental breakdown a few days ago. Crying like it's the end of the world when computer stopped working. I was a Picasso drawing of the hysteria, basically.

My exams are getting near, I'm really not ready; yet this chick keeps asking me about ten euros I borrowed from her a year and something back when we were going to a club they asked me to go to with them... Given her persistence that I should wire her the money (no PayPal tho) I assume she's up to something super shady. Why does she need my account info for?

Anyways, being annoyed by only ten euros (in our currency, it's not much, btw. It's less than two bags of expensive chips, or 5 dozen of the cheapest eggs on the market) and not studying enough, there is also my work. I feel so incompetent that I may just resign. Like... I'm not smart enough for this project. 😢 And I'm aware of it.

Put that on the side with this uni's project, which is very "Urghhhhh" because of too many people working on the same project, some of who need to be sent back to kindergarten to learn how to cooperate with others.

And in the middle of all of that, I'm trying to stay as zen as possible until the next mental breakdown. 😑😑😐

Thank you for reading this rant.

PM and UX designer talks.

About a feature on android with viewpager (swipeable views) and a header with buttons.

PM : We need a back button and a close button on the header.
UX : A customer will be confused by both, with the swipe too.

PM : Then we need a close button alone.
UX : Customer will search for back button and not everyone might swipe left.

PM : We need a back button alone.
UX : Customer might not know how to close the view. He can't keep going back back back.

PM : we don't need any buttons.
UX : Customer should find it easy to close or go back.

PM : bruv.

Owner of the company I freelance for: The proposal I sent yesterday to [PR Company we do work for] got bounced back. They said it was incomplete.

Me: Well no shit, they didn't provide us with a detailed itinerary of everything they need, nor did they give us access to sections that they want copied to the new website. I can't and won't provide a full quote when I don't have all the information needed to build one. I would be guessing at this point and it would be shitty guesses.

Owner: Here's a proposal they got from another company. We need to make it like this [sends file].

Me: They mention a one sentence footnote about what I laid out. Everything else is marketing jargon that I don't know, because I'm a developer, not a marketer. I'm not sure what it is you want me to do, because you're asking the wrong person.

Owner: Are you going to help me or not?

Me: Help you with what? You got my notes. Paraphrase them if you need to, but I have more important things on my agenda, like being a web developer, not a proposal drafter.

Client comes to me.

Client: So my business is colour matching, people visit me and I help match outfits they should wear that works with their hair and eye colour etc.

Me: Ok... and?

Client: Well. I'd like to do this online, someone sends a photo in and I assess it and send them a colour palette back.

Me: Right... How are you going to calibrate this?

Client: What do you mean?

Me: Well, it's a nigh on impossible task to ensure the exact tones and hues they send you in their photo to what you see, and likewise what you send back might look very different based on their brightness and contrast. Colour science is actually quite hard.

Client: But I don't understand they just send a picture right?

Me: Yeah, they can send one, but are you going to have a consistent baseline for your laptop, can you guarantee the brightness is at the same level each and every time?

Client: No... Why would that matter?

Me: I'm bored now, I'm not gonna take this project.

So last week I ranted about the hours I was working, great start this week I'm up at 03:00 to go up north, not going to get back till 20:00 ish. Tomorrow I have to be in Wales for 09:00 so going to have to be up at 04:00 for a 5 hour travel time. Check my emails and my boss says after I get back from Wales tomorrow can we have a design and specification meeting about a "super urgent" product that we have to develop. Oh and Thursday I have to prep everything for going live with a new product Friday.

After working form home for over 18 months now, I start reprioritising things.
I relocated to Ireland almost 3 years ago and I love the people, and country.. but..
The government is a new level of incompetent, selfish (politicians) and clueless. Unlike any other EU government I’ve ever seen.
To this day I’m not allowed to leave the country to see my family. I don’t know many people here because most of them already left so that sucks.

Although my company is great, we got a new female CEO which (just my impression) feels like she gotta prove herself to the world and the company is falling apart since she took over. Seniors leaving on a weekly basis and new managers and grads get hired.

I could go back to the country I grew up in and make my 110k a year (which is a lot in Europe) and I could be close to my fam during covid shit. But I told myself to never go back there because I hate that place..

I’m seriously considering leaving the country I love to go back to the country I hate, make good money for 2-3 years and then come back.. but when thinking about going back there I could cry..

It’s fucked up but COVID makes me consider it..

If I could I would buy a cheap farm somewhere and go off grid 😅

So I ended up installing Arch Linux as the primary OS in my laptop, and to be honest, I'm not very crazy about it. Because I'm someone who likes an elegant UX, I spent three days and over 50 reboots and 5 reinstalls just trying to get Plymouth to work correctly (in the end, I just said screw it and gave up.) I know, I probably messed something up in the installation or configuration, but I didn't really want to deal with it anymore.

I'm not a big fan of the pacman package manager; I prefer apt. There were several applications I couldn't get to work properly, such as Steam, the Tor Browser, and Wine. All in all, I've basically wasted a week trying to get Arch Linux to work as the daily driver on my laptop, but I guess it's just not the distro for me.

I'm going to give Arch one last shot with the Manjaro distro. I'm hoping that Manjaro's simplified installation and configuration will produce a more usable (in my case) OS, and if not, I'll probably be going back to something Debian-based.

I'm not at all saying Arch is a bad distro. I know many people use it as their daily driver, and I have absolutely no problem with that. I'm not writing this to debate which distro is better, I'm just writing about my experience with it. Arch just may not be the distro for someone like me. At least I gave it a shot, right?

Me: We have a new research project for you. We need you to test these 2 new services, see how they will fit into the new application, look at alternatives if necessary etc. At the end we need you to write a report with your findings, showing how you would integrate them to achieve X, Y and Z, and how much it would cost each month.

Dev: sounds good, I'll come back to you when I have it.

*2 and a half weeks later*

Document paragraph 1: The new language translation service doesn't support the languages we need.

Document paragraph 2: Here's my proposal for integrating the new language translation service.

*review*

Me: So I had a look at the doc and it says it doesn't support the languages.

Dev: yeah unfortunately not.

Me: Ok, so when you discovered that, why didn't you look for an alternative? Or come back to me and say it's not going to work.

Dev: I dunno, I thought you'd want to see the rest of the research first.

Me: ... not if we know for 100% undeniable fact that it will never function.

Dev: Ah ok, I didn't think of that. I'll do that next time, don't worry.

... aw how sweet, he thinks there will be a next time. Poor guy.

I've never coded (for work) on vacation. I just turn off my work laptop and my work phone. So I can spend the first week of back to work for going through my email & messages.

I'm not irreplaceable and I work with competent people. (At least that's my goal at work.)

For fuck sake I get that people like python but not everyone is going to use it!

Just want a few articles or tutorials on interpreters and would you fucking look at that, it's all just in fucking python using external libraries...

Then I purchased a couple Linux and Raspberry pi magazines just to have a gander at some of the code examples and what do you think every single piece of code is? C? C++? Vala? Nope, fucking python!

I will eventually finish learning what I can about python but there are other languages that exist that isnt fucking python, give us some C, C# or even bloody JavaScript... Please

Ok rant about python over, back to my hole

Hey hens I'm back on my crack.

How have you all been? Tell me what I've missed (presumably not much as you've all been locked indoors for a while now but hey ho)

I'll be handed a paper soon that says I can write code so I have that going for me (that's also where I've been for the past while)

Before going home, decided to do an upgrade from ubuntu 16.04 to 18.04...

Leave it to do its charm.

*a morning later*
See laptop on off state, "hmm..."
Turning in on, *press power buton*
Booting... Purple-ish screen appear.. Nothing happened for 20 minutes.

"fck."

Hard reboot, going to grub menu,
1. Ubuntu*
2. Advance option

Choose ubuntu.
Booting...
"root mount not found, bla bla bla
Kernel panic..."

"fck."

15 chrome tabs later (on mobile),
Do something on shit...

Finally proceed to login screen.
Insert password, enter.

Loading... Blank... 3 seconds later, tadaaa.. Going back to login screen.
Do it trice, I'm stuck at login screen.

"fck."

20 chrome tabs later,

Finally got in. Have a "what's new" screen.

Ok, feels different... But its slow af. Hmm maybe reboot will do something.

Rebooting...

Login screen, insert password, enter..
3 seconds later..
Bam. Going back to login screen...

"fck."

Another chrome tabs later... Resolved the issue.

And finally I can take a breath, but still has a headache because of little thing likes:
1. Right click not working
2. Workspace not work as expected likes in 16.04
3. Screenshot behavior
4. No animation When moving a window to another workspace.

When almost anything is solved and I'm ready to do my works, I just realised something..

I just wasted 4 hours of my workday.

"fck."

* 1 day of requesting the feature, deadline not for a while*

switch{
case 1:

Manager: How's the new feature going?

Me: I've done a bit of the front end. Here's how it will look.

Manager: Oh great it's done! Does it do ABC as the client requested? Does it also do XYZ that I just thought about this second?

Me: eh this is just part of the front end, I haven't even connected it to the backend - I haven't even started the backend.

case 2:
Manager: How's the new feature going?

Me: I've done a bit of the back end.

Manager: ok. Can I look?

Me: we'll it's just code... *shows them the code*

Manager: oh... so it's nothing really. Call me when it is done
}

Fuck JavaScript, seriously I have spent the last 8 hours trying to build a fucking basic search application that would take me < 1 hour in any other fucking programming language on the planet. I AM FUCKING DONE WITH THIS SHIT. I'd rather pay some dude with a long ass fucking beard who calls himself a "Frontend Engineer" WHATEVER THE FUCK THAT MEANS. Because my backend oriented brain cannot fucking handle all of the frameworks, and modules, and different versions of the same fucking language. Plus its like JavaScript was designed so that you can't not write spaghetti code. FUCK THIS. I'm going back to writing static fucking template code that is used by a fucking backend language that only changes every few fucking years, not every month.

Have a great day. :)

Going on a trip in the middle east in less than 48 hours. Not gonna take my laptop. Can't risk losing it. Most likely will be offline for over a week.

Excited to see the pyramids and the holy sites. I wonder if seeing those holy sites for real would make me religious. 🤔

Most importantly, hope to be back in one piece🤞🏻

IF ONLY DOCUMENTATION WAS IN ENGLISH

In the past I've seen documentation that is great, and documentation that is conspicuous by it's absence.
Over the last decade, I've noticed documentation is getting WORSE.
I believe the reason for this is that those tasked with creating documentation have become so accustomed to the jargon in their own heads that they have LOST THE ABILITY TO COMMUNICATE IN ENGLISH, and as a consequence simply don't bother.
New terms such as "ThingamyJig" are defined as "A Collection of ThingamyJigs" — so you end up going round in circles and get back to square one.
They make little or no effort to provide simple examples.
If only companies who create languages understood that those who wrote the language may not be the best people to write the documentation.

The saga to recover my FuckedIn account continues. Now, they're not replying regarding my latest upload of ID, since the previous one they claimed it was unreadable.

I am going to spam those motherfuckers until the end of time until I have my account back. Can I not sue them for incompetence?

Between high school and college, working in a circuit board manufacturing storeroom.

Fun fact: when we are bagging small boards, we do not gently lay them in containers, they're usually thrown at least 6 feet into a bin of the same type of board after they're placed in the bag. We also don't remake a board when pins are bent, we just bend them back with tweezers. And you know that rule about not touching the gold connectors... Yeah... So much for that... Did I remember to mention that these boards are for medical equipment?

On the bright side, we at least have electrostatic discharge control going on all the time.

Soooo might turn into the lead developer of the web services of 2 fucking schools with the manpower of 2 for which one of us ain't even a developer all because HR put my lead developer in the hospital and he might be so fucking fed up that he may not come back to work.

Fuck
Human
Resources

Holy fuck man.....I was already a lead mobile developer before and i fucking hated every minute of it and the pay raise ain't even gonna be worth it for the ammount of shit that i am going to be required to do.

Fuck this, fingers crossed man I really want my boy to come back cuz I don't wanna deal with this bullshit.

I seriously never thought i would be in this position and by heavens i have been in some shit before.

Fuck fuckity fuck fuck fuck.

Fingers crossed my boy gets better man fr.

windows update bricked my touchpad.
rebooting bricked my keyboards.
reinstalling windows fixed my keyboards but not my touchpad.

this has been going for a week now.
i'm moving back to linux. maybe i'll try arch this time around.

fuck you microsoft.

ps: my touchpad seems to be permanently bricked.

So,

A) I suck at digital drawing.
B) They have not invited me to the third interview like they said they would in the second interview.
C) I am still working on the PhD application. Still think the CV is bad, the SOP sucks, and back and forth emailing professors about recommendation letters. I am not built for this, but who is. So out of comfort zone. So unrelated to actual research or brain capabilities.
D) Moving in with parents is all fun and games and "I can do this", until you get stuck inside with them for over a month because of lockdowns.

... I hope next year is going to be better...

What was wrong with the major updates and clean modern UI? It was the only reason that made us happy.
Now buggy and not surprising minor updates, doesn't really support touch like 8.1, poor animations, poor etc. that looks like a quick without-love development to just "release quickly".

Anyways, who else liked the modern metro UI in 8.1 and sad about going back to traditional desktop on win10?

Serious question here...

I understand alot of devs have had some pretty rough times but things aren't going too flash for me.

I personally know I'm just having a tough patch when it comes to luck but everything is just building up and up to the point it's effecting my personal life and even programming isn't helping...

Normally I will just build something completely random and not related to any 'main' project I have but now everytime I fire up the IDE I just loose all motivation and care for programming...

Just want to know if anyone can sort of recommend anything to just help me get back to working on shit and be sort of myself again and not this mopey me...

Could not fucking sleep at all.

Spent the entire night in a combination of:

Weight lifting
Playing with NestJS(its fucking beautiful)
Watching seven deadly sins on Netflix(current fav anime)

And i am still not tired. Even then I am not in the mood for going to work.
Not sure if I want to risk it and drive there since I know I will be crashing at around noon.

I hate it when this happens.

During the week I would do crazy shit to try and get me to fall asleep.

I would wake up early. Work out, go to work, get back from work, kill myself at the gym and nope.

Still wide fucking awake.

To make it better, my stomach begins to act up and fucking kill me the more I don't sleep for some reason(although it could be related to me piercing my stomach years ago)

I really dislike being human. Such fragile bodies.

But yeah, NestJS is frickin amazing. Typescript is sexy as all hell with it. Just what i was looking for in terms of out of the box architecture for JS apps

As many of you are, I am too a 24/7 IT support for the whole family.

One time I was going back to uni for the week on a bus when my mom calls that her facebook is acting wierd. You guessed it, it was a virus. Then after 10 minutes of struggling I asked my sister to take the phone because she would understand the technial terms more easily and I didn't have mobile net or wifi at the time to use teamviewer. After 10 more minutes the virus was gone and I explained what happened and what not to do next time.
Later that day her friends got the same virus and my mother proudly told them that she already gotten rid of it and helped them remove it too.

Hey ranters!

I'm here to ask a huge favor.
So I used to be on the app more frequently last year, but I started to work on a shit ton of personal/professional projects. I'm not technically back to being a regular again (probably never will be), I'm back to ask all you great devs to possibly check out a platform I'm working on. It's not 100% completed yet, but I'm at that weird 90% mark where you're almost done but you start to find other interesting things to do, so I'm forcing myself to ask people to hop on it to give me that push. It's going to have some interesting (if I say so myself) features.Definitely appreciate it! (Please don't kill me over the UI/UX, I'm primarily a backend dev...but it'll definitely improve by 100% Launch)

AND ONE LAST THING....I don't have a good name for it yet so..there's that..

THANKS!

Building an interface for a client between industrial power quality meters and a database that serves a webapp of data.

Client had heard of a way of sending data between meter and raspberry. From some manager in a big firm.

Currently we where using modus to connect the meter to a raspberry. This method was tested and proofen to work. Both devices could talk to each other in modbus.

Client kept demaning to use mbus, and was nog listening to any reason because the firm suggested it. In the end we end up going modbus to mbus to send it to the raspberry. There the mbus was converted back modbus. Because the meter could not communicate in mbus.

Really weird experience to program something so useless. But protesting about it was going nowhere and taking more time than the changes would take to implant.

OK Mr CEO/President whatever self aggrandizing title you want to call yourself today, where the fuck is your spine! You want to have support help boost your sales but don't tell sales that you are letting support handle some sales and sales is mad. Now you are quivering under the thumb of the Lead of Sales. What the hell. You are the leader of this company.

Why did you not stand up for your decision to begin with? I'm not going to get into whether or not it was good, but if you are going to make a decision to experiment with new things fucking stand by it and let everyone in the company know.

You've exacerbated the division between departments and ton this company further apart. If you don't start standing up for things, you are going to destroy all that you've helped build! Furthermore, I will not simply be your loyal vassal and watch all the people doing support for my products get fucked over. I will leave you high and dry if needed. I really hope you don't make it needed. You gave me a great shot to be honest, I'd hate to have to turn my back on you in anger. But don't think for a second I won't do it.

Your entire programming department has also been put in the cross fire of a fight you just made so much worse. You are the only one who can clean this up. Are you going to stand up for us? Are you gonna stand up for your self? Or will you just break and show us where the real power lies? We will find out soon.

The job hunt is exhausting but trying to keep a positive mindset coz my prospects look good so far. Just cant wait to be done with the interviews (hopefully within the next two weeks) and get back to reading books and binging series when i am not working without the guilt of i should be studying and won’t forgive myself if I don’t pass due to laziness.
I also actually miss writing code and working on a team. Remote work made me realize I absolutely love being a software engineer, i just hated going to the office.
Pls send positive vibes for my upcoming interviews 🙏🏾

Raaaaaaaahhhhh! Danced the whole night until 5:30 on some beautiful playlist on Spotify and then it happened. I wanted the lyrics of a song so I Google it and clicked on a f-ing sportify link in search results. You cancerous cunts. Can't find that playlist back. Raaaaahhh. At least I got one desperado left, got that going on. Almost morning again. Not allowed to f-ing drive. I'll crawl to the f-ing shop to continue the party. Done writing for the week. I'll jump and drink until Monday 7:00 AM

I will be there at the same time I don't have a car so I can get a ride to the airport on Friday and I will be there at the same time I don't have a car so I can get a ride to the airport on Friday and I will be there at the same time I don't have a car so I can get my car out the time to do it again and I look forward to hearing from you in awhile I have a few questions about the other I have a few questions about the same as the other day I will have a talk at you and I hope to see everyone again and again I apologise I didn't get a response to your advertisement for a while but it is a little chilly here is a copy to the store to buy the car is in a good way to start a little more time with the family for a while but it is a little chilly here is a copy to the time of the year for the first time in a long time and I don't want it for a couple days so I'm just trying for you guys I just want a ride with us to get a few things done and I will be there at the end if this works out well for you and your family a very happy and excited about this weekend so I'm just going to go to the store and get back with me and my family is going to be a little late today but I'm still in my car and I will be there at like midnight so much and have to be at work at the moment but I'll try again later in life I have been trying to get a hold of the guy that I have a meeting with you to discuss the details of the job and I have been working in my room so I can get a ride to the airport on Sunday so we are all on my own and I will be there at noon so I'll just be me my money back and I will get it done this weekend but I will be there at the same time and where would we have been in the hospital for a week or two to see you soon and have a great day today love it and it will not work for me to come in and get a new phone or in person and I am not sure how long it would have taken it off and on again and again I apologise I didn't know you were going to be a little late to the game and it will not work on it this morning I was wondering if you had a choice but I don't know if you have any questions please feel free to contact me at any rate is higher up for it and the other is a good time to come in for an appointment with the surgeon on my phone and I don't want to be a good friend to come in at all and the other is a good time to call and talk about what we can do to help you feel better I can come by to pick up the kids from school today so I'm not going anywhere for the next few days and I have a few more days before we get into my car to go out for lunch at home and I will be there at the same time as you can imagine how hard is it to late to get a new car is a lot more done with the interview and the kids will have a good day at school today so I'm not going anywhere for the next two days so we are all on my way home from the gym and then I will be able to make it today because I'm a very nice person who can do it for you if you want to come by and see you soon and have to go back in the office tomorrow morning at work today but I'm going back and I will be there at the same time and where would we have been trying all of us and the rest are you still interested I can send you a picture of the front and back of the house and the kids are going well with the family for a while but it is a little chilly here is a picture of the front and back of the house is in my prayers as a friend but it will have a great weekend and I will be there at the end if this works out well and that your mom and dad are going to be a bit of an emergency at least you have a good day at school today so I'm going to be in the office tomorrow and will be back to the hotel now I'm in bed with a friend and then I will be able to make it to the meeting tonight but I will be there at the same time I was in a hurry and come to the office and I will send the other side and a little about me and you will see that you sent it out and get a good deal and you have the address of where I can get a ride to work on it this week but will have a good day at school today so I'm not going anywhere for the next two days so we are going to be in the office tomorrow and I have been working in the morning and I will get it done this weekend but will be back in the office on Monday and Tuesday and Wednesday are going well for you and your wife is not the case then you have the address of your day goes on and I have been working in the morning and I will be there at the same time I am in need and I'll see what the status is on the way to the airport and then we will have a great day at school today so I'm trying to get a hold of the guy who was the guy who was the guy who is going well and I am going to be out by then but if I can find a way to get the car out the door to go to the store and I have to be in a relationship with a friend and then I will be able to make it to the meeting and will get the info for the guy who was the guys are doing the meeting at the church

In this era, information is much more precious than money itself.

I'm not saying that information wasn't as important back in the days. It's just, at present gathering information is much easier than it ever was!! Especially on people who spend more time on mobiles phones and computers.

Formally stated, Newton's third law is: For every action, there is an equal and opposite reaction. As we're consuming information continuously, going through so many webpages, laughing at menes that are relatable and using apps that we need to perform day to day task. We're also providing information that we don't realize doing. This adds up to determining out individual personality.

One can never be too careful to prevent all these, but we can still minimize the damage.

one of my guys decided to start learning c++ for the fun and fuck of it. We do not use c++ for shit (we web developers in this bitch) and he asked me if in the event of him getting completely fucking stuck he could come to me for guidance, I said sure. I do use c++ for personal game projects....it is mostly very bad C until I need c++, it is horrible seriously, I ain't no expert.

He decides to go with the LLVM. Creates a simple hello world app. Runs clang++ main.cpp -o main.

**QUICK PAUSE**

Done, the CLI returns the prompt back to him. He comes and asks me wtf is going on. I check on my machine(Linux based) and do the exact same thing. Executable comes out.

I check back on his windows machine, try typing the same shit. Nada. It does not throw errors or warnings, and the syntax is fucking fine, can't really fuck up c-outing hello fucking world. FUCKING NADA

I couldn't sit down to troubleshoot since it was still working hours, but this shit is haunting me and I am going ballsack crazy knowing that I won't be able to jump at it until tomorrow.

This just makes me dislike c++, i usually never have issues like that, but then again, I use the microsoft compiler (bitch at me all you want, most game developer tutorials etc use that shit, so does the Cherno, its all i know OK????)

I am going to go crazy sdjkfhasdkjlfghlajkhrfvluidefjbhfksjadhjksdsdsjksdjkl

The best QA in the world is your boss. He always jump in and ask you to show him something that is not completed yet. He then acts like a professional and points out the red is not red enough... You have no word, mark down all the design changes, pass a message to designer, and then, finally, You forgot what's going on in your mind!!! And it takes another hour for you to resume your memory back....

I was happily folowing a tutorial earlier on setting up an email server but the site got taken down for maintenance just as I reached the last step...

IT'S BEEN 6 HOURS NOW AND IT'S STILL NOT BACK UP.

I HAVE NO IDEA WHAT I'M DOING AND I'M GOING TO BREAK SOMETHING AND BE SAD.

I have a big problem guys. I am so stressed out that i have been crying for the past few hours. I joined this company as a fresher 2 years back by signing a bond that i'll have to pay them if I leave the company. The bond is going to be over on 25th Nov,2023. They extended the bond by 3 months. I was a desperate kid back then who had pressure from family. Now the situation is that i have performed well throughout my working period. They are heavily underpaying me. Now i have 2.5 years of experience but freshers are earning more than me now. They had been giving me work every now and then. Now they have made me the lead of a new team where i have to build the world's most useless framework that does not even make any sense. The most suitable developer who was also my senior refused to join the team because he knew how useless the work is and is going to take the troll on him. Now I have to do it.
My manager said that you are going to do this and the deadline is 3 months. Which is not even feasible. This is utterly stupid. It's a waste of time. I am so fucking stressed out because of this and how much freshers(interns whom i trained) are earning more than me.
I have a notice period of 3 months. No companies are willing to hire because of this notice period.
If I resign now, i have to pay them 75k rupees and plus I have to eventually work for 3 months. I can't do this. What to do in this situation.
I am trapped.

YEARS of practice. I had my ups and downs. I learned myself, left it myself early on, came back to it half a year later, continued since. Figured out that web development is not the hell I wanted and quickly fell in love with iOS development in Swift. Been riding on the wind ever since, learning something new every single day.

Today I made something that some time ago took me about 3 weeks in less than an hour. If that’s not an improvement, I don’t know what that is.

Practice makes perfect, don’t forget that. Although it sounds ridiculously cheesy and shit, this is how it goes.

I’m getting drafted tomorrow. Well, this is not exactly a full on draft and joining the IDF (Israeli Defense Force) right NAO, it’s what we call a rough draft: I am having a psychotechnical examination so the military can understand how much I need to go to a cybersecurity unit instead of going to Gaza LMAO.

Remember to exercise kids!

My back is dying. Work equipment is great, but at home my posture is screwed from my chair not going high enough and my desk being too high for my arms to be parallel.

Had my junior test at work yesterday, and...oh boy. I don't think I've ever been so stressed in my life.

>inb4 "welcome to the real world kid"

Yeah yeah I know but god damn, this was too much. I heard from seniors that you get used to everyday stress, it comes with the job, but junior test ( aka "stress test") is the breaking point for most "new" arrivals.

The test itself tho is not even that hard. Dealing with so much stress and time pressure for the first time is what gets you. Not knowing what happens if you don't pass certainly doesn't help.

I broke down at one point and even after finishing, going home (got no sleep) and coming back today, that feeling of hopelessness is still there.

No real point to this rant, I just needed to vent

!rant
today at work i (frontend dev) had an argument about some scss mixins issues, with my boss (senior dev). Not going into detail, I really thought that my method was a lot more efficient and defended my argument strongly until the end. In the end of discussion I saw/accepted that boss' method was better and he said he's nevertheless proud of me for defending what I believed was right. (it's been 2 years since I moved into this country and its language is my 5th one, so I'm only level B2, most of the time I back up from having a deep discussion knowing that my language skill won't take me that far) I really appreciated that feedback from him and it truly made my day. Thank you boss! You're cool!

Oh god... technical decisions should be taken by people who actually know what they are doing and even so still counter-checked and not followed blindly.

I am currently working in a company that wasted millions by trying to implement micro-services where they don't belong and didn't step back when they realize it was a mistake

(protip: micro-services usually don't belong in most places).

Now we're dealing with the sunken costs fallacy and I am seriously believing that the company is going bust in a few months. Let's wait and see.

Had to wake up 1 hour earlier today, and the worry of that kept me awake last night. Now I sit here like a zombie, hating the day that I'm going to have, which is not full of exciting coding with headphones on and Babymetal in my ears, but full of meetings.
I already see my eyes tearing up, reality fading, a guy in a meeting asking me something and pulling me back to reality so that I could stare blankly into his eyes and reply a generic "Yeah, I agree with your proposal", so everyone will think that I'm on drugs or something.

Welp... gotta go. Fuck.

!dev

I'm one of those self improvement assholes. I want to always strive to be better and to see what works and what doesn't.

One way to keep track of how satisfied I am with my life, I have a prompt at 20:00 to self report a score, 1-5 how happy I am.

It's like a minimal journaling system. Sometimes I motivate why I feel like shit.

Does anyone here do something similar? Not counting your GitHub commits.

Do you track progress when doing things in some visual way? Projects, working out, whatever.

Here's a post of my life a few months going back. I kind of like this system.

Writing my code, go to run it and boom its not working. I pull up stack over flow to get some insight. At this point i was working on my code for countless hours and became a bit annoyed so i decided to copy what someone wrote on stack over flow delete my code where i thought it was flawed. I run it and Blam bugged the hell outa my code. So i undo go back to my original. Turn to a friend and ask what do you thinks going wrong. He resets my browser and there it goes it works. I just kind of gave him a blank stare and thought to myself Im a dumbass!

Going through the conversation for xxxxth time with my business partner, why we will not launch a new product on top of pre-made PHP script / plugin.

Just got our company into TDD, and automated QA via CI server & code checks etc, PLEASE stop trying to drag us back into the land of spaghetti code & bug legions in production. That's all thxbye.

Boss: so we've got to call an app to verify data in this project. But I've got no more info and I'm on holiday next week. Please contact GuyA next week.
Me: ok I guess?
*writes email to GuyA*
GuyB: GuyA is on holiday please hold the line
*1 week later*
GuyA: we need more time it's not ready yet
*2 weeks later?
Me: so?
GuyA: yeah it's ready here's the wsdl etc your client already has the password
*1 week later*
Me: yeah so I got the data but the api says my auth isn't working
GuyB: yeah your user isn't activated on the test system. I'm gonna forward that and come back at you
*1 week later*
GuyA: so we're going live in about 2 weeks hows testing going?
Me: well I'm still waiting for the response and activation
*suddenly it works*
Me: yeah so auth is working but i can't find any data. Is there any special test data?
GuyA: oh no there is NO test data on the test system. You need to wait for GuyB but he us not here today...
Me: are you fking kidding Me?????

... no response since then and it's been days....

Manager: Tell me what you are looking for in your job, I know this from your coworkers, but not you.
Me: I honestly don't know anymore. After all this time my motivation is gone and I don't know where I'm going.
Manager: If you could go back to school knowing all you know now, what would you do?
Me:...
Me: I don't know.
Manager: maybe try to think about that.

He doesn't realize I've been thinking about this for years.
I stopped caring at some point and just act.
I didn't tell him I was looking for a new job because any energy I had left is being consumed by this company.

Almost died few minutes ago. My laptop was plugged to power, while I was using it, for last one hour. Then power cut and my laptop went off too. I was really afraid. Just 9 months ago I purchased a new battery for my laptop. When power came back, and I restarted my laptop, to check status, it was saying "Plugged in. Not charging" on windows. Now I was in serious shock. "Fuck battery died again. This time so soon". Also no red light which reflects charging but white, which reflects "laptop running on direct supply". It gave me some indication when it stopped showing red light during charging for last couple of days

I removed the battery and reinserted it. Replugged the charger. Now it's charging. And red light is back

This makes me even more serious. As similar to this, is what happened with me last time battery died.

Now let's see whether my laptop battery is going to see this night or not. Next few hours are crucial

A message to designers and developers:

please please please stop being so touchy about your designs/software. The final work is meant to be used/enjoyed by end users, customers, clients, young people, old people, disabled people, short attention span people, irrational people, patient people etc. So if they say it's not good enough accept it go back and make it simpler (not necessarily better but simpler) and move on!!

Stop going into defence mode and start throwing your toys out the pram or giving people the silent treatment.

Sorry just been on the receiving end and boy is childish.

going out of the cafe when some stranger stops me, he asks if I'm a programmer, said his friend told him,
i was like yeah, i mostly do web stuff, but can work on any project.
he then said, nah it's just about hacking that person, or even just his facebook account, i suppose it can be done..
then he looked at me noticing that I'm a few mood calories away from murdering his sorry ass.
he asks if it's not bothersome to ask
i said nah it's fine, just that every word you said after "hack" is bothering me terribly,
he just stepped back and walked away

So I've been really Ill the past few days, like litterly been in bed for two days, popping pills like there going out of fashion. I contact work and get the typical "get well soon" so I get a message today asking how I'm doing (still Ill), I said I'll be back Monday and ask if anything is urgent that needs to be done first thing. So I get a list:

Project A: Deadline Monday
Project B: final review Tuesday
Project C: Still waiting on feedback

So I ask any chance we can extend the deadlines by a day or so I have enough time to catch up even though I'm going to have to rush it as I've been off.

Answer.. nope there non negotiable.. oh

So they want basically three days work done in one day, given the fact I still might not be 100%. Jesus Christ 😂

Quick Edit, I wasn't told there were deadlines.

I'm the lead dev on this team. The project is split into multiple separate modules to comply with separation of concerns, and so new devs don't need the whole fucking codebase (risking them running away with everything) to contribute to the project as a whole.

So we don't need a fucking config file to enable and disable features.

So we don't need to upload a 500mb monolith every time we want to test a change.

So we can test old fucking versions of modules without merging it back into the entire codebase.

What did this fucking dev do? He was having one small issue with Maven. One. It wasn't updating his local snapshots to the correct Artifactory version.

He decided, instead of trying to fucking fix it: HEY, LETS IGNORE THE LEAD DEV'S DEMAND TO KEEP THEM SEPARATE. IM GOING TO MERGE THEM INTO ONE MODULE FOR SOME FUCKING REASON.

I refuse to continue working with this dev if he's going to sidestep my demands and undermine my authority. He wants to go it alone? Be my fucking guest. I'm not touching his shitty single-codebase monolithic monstrosity.

If this is going to be a regular fucking occurrence, he can eat a dick and choke on it.

I am now sitting in my apartment lobby after rushing home this morning because of a FedEx Delivery.

They said they can't get access to the building then how the fuck did this FedEx package get in between when I got back and when I came down?

Now they said there are different trucks... And my service could come later today.

It wasn't even supposed to come today but I guess maybe that's good since I took today off anyway...

Now I'm just stake out here all day and if it's not here..... Im going to aim to make FedEx the next Facebook or Panama Paper PR crisis

Fuck. I just want to fucking use OpenCV on CLion on Windows. Why the fuck do I need twenty fucking PhD's in quantum rocket science to set up a simple project with Cmake?

During the time I just wasted trying to get the correct library to link properly, I could have rewritten all of Tesla's fucking CV functionality from scratch, but instead here I am spending literal fucking hours googling why the fuck does 'recursive_mutex' not name a fucking type in namespace 'std' on mingw.

Fuck C++ I'm going back to C# where I can literally install OpenCV and all of its fucking dependencies from nuget with ***ONE*** fucking click.

It took literally days to get our software installed onto the client VMs and get the services started correctly.

On our own test VMs the same task takes all of about an hour or so. Mind you these VMs are supposed to be created and match the client's environment almost too the T. Same configurations, same third party software, same environment variables and the whole 9 yards.

This was not the case at all.

Environment variables were not set, third party software was not installed, and I honestly don't remember the list of things wrong with how they setup the VM. Sparing the details, the errors were also not helpful.

They also gave us critical information we needed for development days before we were going on site to test. The amount of hackery we had to do could be a completely separate rant on its own.

While desperately trying to to stay sane long enough to get our services started, the only thing I could think was how great it would be if there was a fire or something. Anything, just to have an excuse to go back to the hotel and actually sleep. The second day there we finally had everything installed and running.

I shit you not, just as we began our first test, the fire alarms went off.

At this point in time the team was extremely (pissed tf off) annoyed to put it mildly. Assuming it was just a drill, we left our stuff and went to eat dinner. After we came back we found out it in fact was not a drill...

Moral of the story:
Don't wish bad fortune on a customer even if out of impulsive spite.

Other moral of the story:
Don't leave your belongings behind only because you think the fire alarms are just a fire drill. It may not be.

P.S. Karma's a bitch.

After I took some time off from work, I decided to accept the offer for maintenance of two projects. Those are from two old clients, so I think I will not stress too much, since I know what to expect most of the time.

The issue is, sometimes I have a hard time to keep concentration. In the past, I could work for 3h straight, totally focused, would pause for 20min for stretch, and then come back to work. Now I can only focus for 30min or 1h, and after a pause, it's hard to concentrate again.

There is a lot going on in my life right now, and I know the worry is probably distracting me. I'm trying to listen instrumental music, drinking coffee... But that's not enough. Somebody has any tip?

My biggest challenge was trying to convince my old boss why things need to be done the way I'm saying and not the way he wants (of course, arch wise and not business wise)

After giving up, I ended up going back to collage, studying Masters in Business Administration just to know how managers think, took me two years, and now I'm in my final semester, even though I left my old job, I am now able to handle things in a better way in my current one regardless if I was arguing with general manager, or project manager, luckily clients are not allowed anywhere near me ...

Ugh power's out.

Luckily it's pretty warm out so we're not suffering. I'd normally have a fire going but my fireplace is out of order.

I hauled in my portable generator in the hopes that if I was well prepared the power would come back on and it would have been wasted effort but I may end up running it later to cool down the refrigerator and maybe charge a few batteries.

Hopefully I have power by morning or I'll have a hard time getting our services deployed...

Today's episode of Bluey is called: "I am not ready to go back to work after a week long mandatory vacation in which I will go back into a space that has made my passion into a shitless grabs for money"

Seriously, If I hear "the president of the institution does not like <X>" I will blow my brains out.

What is worse, every "leAderShiP" meeting I ask if shit is actually a policy towards were my department head says "no, but the boss does not like <X>" <--- then fucking make it a policy.

Seriously, I have a wife, I have but one woman to keep happy, I ain't about to break my back on dumb shit that some lady dislikes when I already have to keep 1 woman happy.

Going to work is a paycheck to me, but fuck man, I am seriously leaving. Good luck trying to find fkers this part of town that can patch my software be it that I wrote it in the most esoteric shit known to mankind on these modern days.

Might start listening to recruiters, I get about 50 offers a day.

Why for fucks sake can't I motivate myself to finish my thesis?

I mean I guess it is because I already got my third raise in my current (full-time) job because of hard work, which left not much time for side projects (or thesis writing).

On top of that, there is nothing which forces me to finish. My Prof. does not really care. I would probably not earn more because of a higher degree. Only thing is I have to pay the fee for enrolment once a semester.

Also, going back to my thesis project after some time, and having to upgrade all the npm modules in there does not help.

Even though I already have a working backend and proof-of-concept app, something blocks me from finishing all this work.

It is a curse. I would do so many side projects, but I tell myself that I first have to finish my thesis before doing anything else.

It is some kind of loop and I have yet to find the return condition.

Right,i consider myself a pretty damn good dev... I can back up everything I say to prove that I'm right on not lying to clients

But I see all these devs who do lie... Who withold data from clients cause it's not great.

And I go to clients and prove that they are lying not doing it right.

But I know saying to them... Oi your current devs are shit fire them ... Isn't a good way to get them as a client

Me and my company are open and honest ... we go all out on all of our projects. I work nonstop. It is seriously baffling the kind of developers are out there and how bad they can be I'm... Seriously just.... Urgh 😖

How should I go about talking to clients without going ... Fire them quick or saying that in a ... More humble respectful way...

I need more clients ... To survive and I don't mind coming across as a dick as long as they understand what's going on and that they are people ripped off by these asshole devs

So i informed my intent to leave the job in few months in pursuit of learning something new in tech. Boss is trying to convince me to not leave and said i should consider learning it after work hours. In fact, in his opinion, the best way to learn is just going ahead and learning it while doing it in the project ( which usually has impossible deadline and fugly code by colleagues who never thinks of good coding practices when typing their shit ).

Well guess what boss, I don't want to just live a life staring at monitor all day. I don't want to kill my eyes either.

Following his advise and not quitting would mean living a slave life.

I have other plans actually. Like being self employed and traveling the world which would be impossible if i follow the routine life.

Fun fact: he claimed he made an AI car back in 90s!

He also thinks I can't sense BS!😏

An incomplete list of 2018 personal dev goals:

* do more web development (It's fun. In a crude way.)
* finish the smart lamp I started building in 2016 ...
* fix up more electronic devices while learning their inner workings
* learn Python and some other language
* get myself a blog again
* get that testautomation thing which is haunting me in my dreams already to production
* be more relaxed
* do some home automation while not cursing all that much

What I should do: Go back to doing construction and get into house flipping

What Id actually do: Be salty AF move to some tropical island and sell italian ice on the beach. I am not going back to construction lol

Not dev related but what is the fucking point of someone saying I'm going there to do that and when i ask them to show me THAT what they did they say "oh it was so bad I'm not gonna show you haha"

Like how do i explain it without being rude.....

........

Here's a savage example scenario

---

Your wife: "i just came back from a mountain in the middle of nowhere filming an ad and in gonna be in that ad"

You: "cool. Id love to see that ad, could you show it to me?"

Your wife: "noo i was so ugly and it was so bad im not gonna show u"

---

What are you gonna think? What was your wife filming secretly behind your back and she doesnt want to show you? Was she even filming in the first place? Or was she fucking a guy? What is one supposed to think of this conversation? Why fucking tell me ur gonna go there and do that and then not talk about it at all after doing it? What the FUCK who DOES THAT ???

I've now worked on both monolithic solutions and microapps/microservices. I gotta say I'm not sold on the new approach. There's so much overhead! You don't have to know your way around one solution -- no, now you need to know your way around 100 solutions. Debugging? Yeah, good luck with that. You don't have to provision one environment for dev, test, staging, and prod. No, now you need 100 environments per... environment. Now, you need a dedicated fulltime devops person. Now devs can check in breaking changes because their code compiles fine in that one tiny microapp. The extra costs go on and on and on. I get the theoretical benefits but holy crap you pay for it dearly. Going back to monolithic is so satisfying. You just address the bug or new feature head on without the ceremony and complexity. You know you're not crapping on other people's day (compilation-wise) because the entire solution compiles.

...and yeah, I'm getting old. So get off the lawn! ;)

Have you heard of "Thunder client"? Meh... That shit is cool. I came across it on my YouTube recommendations, installed and gave it a try. I'm probably not going back to postman.

I'm working on a bug I can't figure out. I go out for a smoke to clear my mind. Some time passes, I get an idea, finish smoking and I wanna go back up to my desk ASAP.

I have to go up to floor 14. Building has a basic elevator with 2 buttons:
UP arrow - "I wanna go up"
DOWN arrow - "I wanna go down"

User-friendly, intuitive, idiot-proof, you might think. NOPE.

Elevator stops at floor 1 because moron who wants to go down pressed all 2 of the over-intuitive buttons.
Floor 1 moron: "Going up?"
Other people: "Yes"
Floor 1 moron: "Oh"
Me (in my mind): "Oh? BITCH, there's an idicator telling you where it's going. Don't fucking press UP if you're not going up."
Moving on.

Elevator stops at floor 3.
Frustration sets in.
Floor 3 brainlet steps in, doors close.
Floor 3 brainlet takes eyes off phone screen and realises we're going up.
Floor 3 brainlet makes an "oops" kinda noise because "it" obviously wanted to go down.
Floor 3 brainlet stops elevator at floor 5 because "it" doesn't want to go all the way up to floor 14.
Rage sets in.
Me (in my mind): "I hope I get lung cancer so I don't have to deal with this shit anymore"
Moving on.

No more incidents, I calm down. I get to my desk and begin brainstorming about elevator coding. My preferred idea so far:

Elevator is called at floor X but nobody steps in? Elevator doesn't stop at that floor for 2 hours. elevators.size() strikes and the entire floor uses stairs, BITCH.

I spend 1 hour reading rants and writing this. Now I have to get back to my bug. I would appreciate other punishment ideas for elevator misuse.

To anyone sufferring/going to suffer from kidney stones, here's a golden rule what to do when the episode kicks in [the sooner you start - the better]: 2 pills of no-spa, 1 tablet of painkillers [ibuprofen/dolmen]. As soon as no-spa kicks in and relaxes your spasm -- become a fucking breakdancer. I shit you not. Start bending, spinning, jumping, swimming like a fucking hurricane. The more you move, the better chances are you'll make that lump of rock move down the pipes and unclog your drainage.

Did it this week. Did not need to come back to the ER.

This was my 5th stone. Many more to come [Pending...].

I don't understand why do they make us lay in bed in the hospital if we have kidney stones. They should pump us with no-spa and make us do gymnastics, acrobatics and brakedancing instead!

So after three days FINALLY I was able to make the fragment NOT reload itself when going back to it from the second fragment. Used show() and hide() in fragmentTransaction. Yayyyy! :D

A tale of silos, pivots, and mismanagement.

Background: Our consultancy has been working with this client for over a year now. It started with some of our back-end devs working on the API.

We are in Canada. The client is located in the US. There are two other teams in Canada. The client has an overseas company contracted to do the front-end of the app. And at the time we started, there was a 'UX consultancy' also in the US.

I joined the project several months in to replace the then-defunct UX company. I was the only UX consultant on the project at that time. I was also to build out a functional front-end 'prototype' (Vue/Scss) ahead of the other teams so that we could begin tying the fractured arms of the product together.

At this point there was a partial spec for the back-end, a somewhat architected API, a loose idea of a basic front-end, and a smattering of ideas, concepts, sketches, and horrific wireframes scattered about various places online.

At this point we had:
One back-end
One front-end
One functional prototype
One back-end Jira board
One front-end Jira board
No task-management for UX

You might get where this is going...

None of the teams had shared meetings. None of the team leads spoke to each other. Each team had their own terms, their own trajectory, and their own goals.

Just as our team started pushing for more alignment, and we began having shared meetings, the client decided to pivot the product in another direction.

Now we had:
One back-end
One original front-end
One first-pivot front-end
Two functional prototypes
One front-end Jira board
One back-end Jira board

No worries. We're professionals. We do this all the time. We rolled with it and we shifted focus to a new direction, with the same goals in mind internally to keep things aligned and moving along.

Slowly, the client hired managers to start leading everything in the same direction. Things started to look up. The back-end team and the product and UX teams started aligning goals and working toward the same objectives.

Then the client shifted directions again. This time bigger. More 'verticals'. I was to leave the previous 'prototypes' behind, and feature-freeze them to work on the new direction.

One back-end
One conceptual 'new' back-end
One original front-end
One first-pivot front-end
One 'all verticals' front-end
One functional prototype
One back-end Jira board
One front-end Jira board
One product Jira board
One UX Jira board

Meanwhile, the back-end team, the front-end team overseas, all kept moving in the previously agreed-upon direction.

At this stage, probably 6 months in, the 'prototypes' were much less proper 'prototypes' but actually just full apps (with a stubbed back-end since I was never given permission or support to access the actual back-end).

The state of things today:
Back to one back-end
One original front-end
One first-pivot front-end
One 'all verticals' front-end
One 'working' front-end
One 'QA' front-end
One 'demo' front-end
One functional prototype
One back-end Jira board
Two front-end Jira boards
One current product Jira board
One future product Jira board
One current UX Jira board
One future UX Jira board
One QA Jira board

I report to approximately 4 people remotely (depending on the task or the week).

There are three representatives from 'product' who dictate features and priorities (they often do not align).

I still maintain the 'prototype' to this day. The front-end team does not have access to the code of this 'prototype' (the clients' request). The client's QA team does not test against the 'prototype'.

The demos of the front-end version of the product include peanut-gallery design-by-committee 'bug call-outs', feature requests, and scope creep by attendees in the dozens from all manner of teams and directors.

This 3 day weekend couldn’t come at a better time! Today has done everything it can to delay it and everything has been a superb annoyance!

It started off with our internal systems going down, a frustratingly tedious project proposal process, our phones went down, off the wall calls to support all day causing them to ask me junk.

As a parting gift the pending windows update and it completely crashed my development VM and corrupted my install of virtual box. I had planed in only working a half day, but worked 6.5 hours, hit traffic al over. Was late to the event.

Not I get here and there’s a bunch of smokers outside and I could reallllllly use a drag. But I’m not gonna. 😒

Just ready to kick back and do non computer things til Tuesday. 😎

So all my friends keep calling me a negative person because I always correct them on how easily they can be hacked.
Friend: Hey (my name) I am going to buy a new computer and I will make you happy and not download illegal games on to it.
Me: That's a really good idea. Now shouldn't you also buy a virusscanner or at least make a full system back-up in case you get hacked.
Two days later
Friend: Yeah I got my new pc and can now finally play Kerbal Space Progran on it. It's stupid though that this dlc costs money so I downloaded it illegaly. But don't worry. I'll stop doing that from now on.
Another two days later I am spending my whole day trying to fix his computer because he downloaded a Trojan Horse that took over his computer and he had no virusscanner or back-up.
The problem is that I am 99 percent sure that such a thing is going to happen again and he'll be standing on my doorstep to fix it for him. Just let the doomsayer that is good with computers fix it and repeat the whole process all over again😒.

Fuck you windows!!!
I had to leave town but wanted some surveillance and had no cctv or ip camera set up. So I added my laptop to teamviewer and used its webcam.
Now its not showing up on teamviewer and most likely because WINDOWS SCHEDULED A MAJOR UPDATE
It probably rebooted and went on to boot into ubuntu. Should have fucking run ubuntu in the first place. I am going to be so furious when I get back.

*in case you are wondering, I had to leave in a hurry and didn't go for ubuntu because I had never used the camera in it and wasn't sure if ubuntu had the required drivers *

Anyone elsd burned the fuck out?

I fucking am!

What is another career in tech I can move to from developer? Don’t mind going back to school to pick up new skills.

Not even on devrant anyone like I was.

Project isn’t motivating me but I want to finish it but I can’t finish it because I’m not motivated to do it.

Should I keep going and come back when I feel motivated, or just keep going even though it’s a tough one.

Okay then, ex-android user there.

It started with Xperia TX - it was flagship Sony phone back then. It blew my mind when I touched it for the first time. You know, exploring android for the first time in my life was amazing.

It ran just well for about a year. Then it started to fall apart. I need to clarify that I kept it non-rooted, full stock. I'm not into that customization things.

At first, I noticed significant lags. They were everywhere. The longer I used smartphone, the more lags I encountered. I did factory reset, but lags haven't gone anywhere.

Year 2. Front camera stopped working. Battery became unreliable as fuck, going down to 40% and then instantly to zero. What?

Year 3. Camera broke. It refused to start, just giving me "Camera is not available" error.

I tried factory reset again. It helped at first, but month have passed and all that issues came back. And it also became sluggish as fuck.

Got Meizu m3s year ago. The exact same story. Long story short, in one year I got this:
1. Black spots on every picture I take. Much likely a matrix issue.
2. Camera also became slow as fuck, requiring about 10 seconds to even start.
3. Vertical stripes all along the screen. I never dropped my phone, it just appeared once and became brighter and brighter every day I used the phone.
4. Two huge yellow spots on screen. I think it happened because phone's cpu heat up the screen and it broke.

But the most important thing is that fucking lags chased me in every app, they were everywhere. Fucking tiny-ass lags. And they're not going anywhere, they're become more and more significant with time.

Don't say me about oneplus, samsungs and other top android phones. They are conceptually the same, the only different thing is hardware.

That's why I switched. IPhone has its downsides, but it's silky smooth. And my friend's iPhone 4 (not s) feels just as smooth as my brand new se.

I'm not going to jailbreak it. I don't need customizing the hell out of it.

I just needed quick and reliable phone, and SE seems to be exactly what I wanted.

Peace to android folks tho✌️

Me: Wrote and unit testing code for a user story.

Day of a Merge
PO: We need to back out the code you wrote. We have not gotten approval from legal.

Me: Uhhh well it's not going live for 4 weeks still and not harming anything but if you insist, ok.....

2 Days Later
PO: Ok legal approved the changes can you put that back in?

Me: 😡🖕🏻

How do you deal with anti-competitive clauses in contracts with your employer?
I have found them to be unavoidable here in the field of IT/CS related fields, and I don't want that to affect my future career as much.

My current strategy is to gain more of other skills than just in software development, so I can fall back on those skills for a different field (e.g. DevOps, sysadmin, ...) instead of being unemployed for a year because I didn't like my workplace anymore.

The only other way I can think of would be to open my own company, but I'm not going to be ready to do that right after school.

Any other thoughts?

I think I need to cut back on coffee. Maybe yesterday's was extra poyent but don't think I got much sleep last night... And now I'm taking a sick afternoon cuz I think I just crashed...

I need to sleep now... But then tonight.... hopefully it's not going into a loop...

Trying to make use of Google Maps. Search results are always sorted by "most relevant" by default, instead of by distance. Always I switch to distance, next search goes "most relevant" instead, which should be labelled "most irrelevant" instead, as it seems to be an excuse to show a list with promoted businesses not only far away, but often unrelated to my actual query. Wasn't Google supposed to be some sort of search engine experts? or at least the lesser evil of search engines? Oh wait, no, they're actually an advertising company, and it shows. Fuck you, Google. Where am I going to throw my Pixel phone and why did I open your shitty apps in the first place? I should switch MY own defaults back to Open Street Map etc.

I HATE it when client does not know what he wants. Removed a functionality only to be added back again with all the ripples going through the code¡¡¡¡¡

ARGH¡¡¡¡¡¡ FUCK ME

Where's my exclamation mark u shitty SwiftKey keyboard¿¿¿¿

Hello.
I am a student of Computer Science Engineering (Bachelor of Technology). I am 3 years into this 4-year course. I am strong in Data structures and Algorithms, and passionate to add more stuff to this list.

I am really done with this University coursework, and want to explore more (specifically, want to do something that is practical, and matters). I, obviously cannot leave the Uni, but I want to make my time at home more productive. Not just to me, but everyone.

But:
1. I don't know where to start.
2. I teach myself everything, and hence, there is much difference between what I know and what people need, and I'm kind of scared of ruining/wasting other's time.

If there is someone out here who has the time out of his/her busy schedule to guide and set me on a path, please do help me. It's getting weird in my head.

Languages I know: C(took a 1-year course), Python, JavaScript [learning JAVA], Oracle, Visual Basic

Things I have done before:
* Developed a fullstack website for Indian Railways (going live in May 2019) [used Python for back end]

I have a sincere need from within to do this, and I am going to learn whatever more I need to, in order to fulfill your requirements. Please just show me WHAT and from WHERE.

Kindly do get back.