Details
-
AboutFull time chemistry student Time will destroy you :wq
-
SkillsJavaScript, python3, MongoDB
-
LocationDublin, Ireland
-
Github
Joined devRant on 2/7/2017
Join devRant
Do all the things like
++ or -- rants, post your own rants, comment on others' rants and build your customized dev avatar
Sign Up
Pipeless API
From the creators of devRant, Pipeless lets you power real-time personalized recommendations and activity feeds using a simple API
Learn More
-
Girl: "hey"
My Brain:
java.lang.NullPointerException:
at net.brain.functions.Talk.retrieveSpeech(Talk.java:2978)
at net.brain.functions.Talk.createFlirtyResponse(Talk.java:3132)
Me: null
*Girl walks away*20 -
Xpost from /r/sysadmin:
I occasionally see posts from people who seem like they want to spend every waking hour of every waking minute working on home lab stuff and studying for certs.
If you do this, you're missing out on life which you will regret later, but even if you don't care about missing out on life, it actually is hurting your career.
Being well rounded helps you interact with others at work in a number of ways. It makes you less one dimensional as "the computers guy" and it also gives you topics to discuss with people. If you know how to cook, or brew beer, or bake bread you end up using a lot of your technical and troubleshooting skills. Biking long distancing and learning how to fix your bike helps with your troubleshooting skills too. You learn to look at things from other angles.
Reading novels or writing poetry or making art work also helps because it exercises your brain. Woodworking or metal working involve a lot of skills that'd help your IT career including project planning and measuring and budgeting for each project. Working on cars or motorcycles would be similar. You just have to do SOMETHING.
I have a member of my team who literally has nothing going on in his life other than studying for certs. No friends, no hobbies, and he basically eats nothing but McDonalds and frozen dinners because even making a meal takes time away from his studying. He thinks means he's dedicated and will experience great career success.
But instead he has nothing to talk to anyone about, and when I say nothing, I mean literally nothing. It's borderline terrifying. Even if he was into comic books and video games it might help, which might help him relate to SOME of the IT staff even if the rest of the people at the company know nothing about it. But he doesn't even have that.
This isn't a solitary field anymore. Even if you truly are "the best" you still have to interact with other people and stay mentally stable enough to not burn out. Even if you know more than everyone else (or think you do) you have to try to broaden your horizons.10 -
Wan't your own personal devBanner?
Now you can have one!
We're building a powerful banner generator over here: https://devrant.com/collabs/...
The first version is up and running, still basic tho.
You can generate your own by calling this URL:
https://devrant.nuernberger.kim/api...
You'll have to replace "Kimmax" with your devrant name and the value after subtext with the extra text.
A cool domain is already on it's way!
We'll be working on a frontend and a ton of extra features to make this banner even more awesome.
If you got any nice ideas add them to the issue tracker here: https://github.com/cozyplanes/...
Have fun!95 -
Me and my love-hate Linux.
I lost virginity really early. In the age of 5 it was my first time with windows 95. I spend almost 10 years with Windows before something happened that would change everything. I met Linux. Her forename was Arch. I had a crush on her right from the beginning. It didn't take long for me to abandon windows. Arch had everything I wanted. She had latex which was pretty hot and looked simply and elegant on her. Sometimes she was really hard to deal with and almost drove me crazy, but I knew I fell in love.
Until that day. I had to write a short paper which was quite fun and Linux helped me alot. It was a breeze to work with her. The evening before the deadline she was quite thoughtful. She sometimes was, so I thought it'll be alright, but this time was different. She struggled a bit, so I put her to sleep and she never woke up. I brought her to the emergency lab which was open 24/7. Since no one was there I had todo the surgery myself. After 5 hours I was almost to tired to continue when she finally woke up. I asked her about the things she should remember for me - then I killed her. I started to hate Linux for what she had done to me. The unbelievable stress and horror.
I returned to Windows. Besides that she got a bit more curious what I was doing when and where nothing really changed and she was glad to have me back. I just was happy how simple our relationship was.
One day then, I couldn't believe it at first, I met Archs sister. Manjaro. No matter how strange that is, but it was as if I would meet Linux again for the first time. She was just a bit simpler but as flexible as arch. Since then we are happy together. It seems that we both just grew up a little.
And with Windows? She got even more curious! Actually I have the feeling she is stalking me now, but I don't regret anything!15 -
I am fucking dying of laughter right now. 😁
Today I got a push message of the invoicing app I use from time to time and the message literally just said "lol" (without even the usual pre-fix of the app name or anything).
So after not figuring out where that could have come from and obviously theres no private messaging etc. in that app, I contacted support and they reacted surprisingly good and at same time hilariously good; they pushed now a team towards investigating that, as apparently I wasn't the only one.
https://support.waveapps.com/hc/...
I wonder who fucked up and literally pushed "lol" to thousands of people. 😂8 -
A friend of mine is heavily into java. Like seriously... programming teachers at our school ask him for help.
Everytime he gets drunk he starts saying the weirdest things like "DUDE what's your alpha value I can hardly see you".
He greets me with "What's up socket boy" and after throwing up he thinks about the best ways to sort the data. (his vomit)
Has anyone else had such experiences? I want to hear some funny stories! :D12 -
Boot up/shut down(different os edition)
Windows:
......eh?....
......zzzz......z...eh?
......
.....
....hold up.....zzz
....eh? Oh right!....
......z.....ok ok I am here...what?
....z...zzzzzz
Mac OS:
........
.......
..eh?
...ok I am here wtf u want?
Linux (most distros)
....snores coke...what?I AM HERE LETS GO MOFOCKA
-----shut down
Windows:
Still eating glue...
....glue....glue....glue...
WINDOWS WILL UPDATE WHE...whst are you doing with that pillow shshuahahhaah..x___x
Mac OS
.....
..ok fuck u bye whatever
Linux (most distros)
Ok bye xoxoxo talk to you lateer
**dead**32 -
This rant is devoted to my study friends. You see, I never knew what it was to not have people making fun of you/bullying you until I started my study.
Elementary school + highschool was one big mess of bullying, being made fun of and hardly having any friends.
At highschool I decided I wanted to go into IT. Especially programming. Programming in particular because when I was programming, I, for once, was the one in control. The code listened to me and for that tiny moment I was god.
Never really had much friends though and when I told my parents I wanted to do an MBO study (application development), my mother warned me that although she and my dad supported me with whatever my decision would be, MBO level studies were rough because of the general mindset/atmosphere there.
I thought fuck it, I want to do programming because that seems awesome and maybe I'll even make some friends with the same interests!
Then study arrived. Met a few guys with similar interests and we started hanging out together.
And then it came back just like before. Two guys who loved bullying and I was still a quite easy target because I couldn't stand up for myself.
But, then something happened. I liked a girl, she was in the hallway and two of the bullies (there were about 4-5 in total) got up and started fucking around with me (about her) and I just sat there, not daring to do anything with tears in my eyes.
Then two of my classmates noticed it, quickly came to my desk and started pushing the guys away with 'back the fuck off, what the fuck has he done to you?!'. Then one of those guys (now still about my best friend) came to me to see if I was alright.
We started talking. Then at some point, another bully had a go at me. This would be the final time. He was about 2 meters tall (I was about 160cm or something) and stood there in the door opening with a very nasty smile saying all nasty stuff, trying to intimidate me and probably tried to make me feel like crap again.
Nice guy on my right asked me to step to the left. Gave that guy a huge fucking foot in his chest and he smacked onto the ground. Made a gentleman's sign like 'go ahead, sir!' while gesturing towards the door.
From that moment on the bullying stopped. Throughout my study, some other bad things happened but those guys were always there for me.
Although I've lost touch with most of the guys (they're on social media, I'm not really), we still meet up once in a while and have a lot of beers while talking and laughing and thinking back to the good times we had together.
The study wasn't the best for what we were taught as in studying but it's the best choice I've ever made nonetheless.
Oh and that best friend and I still have loads of contact!13 -
Sometimes you run your code,
it doesn't work, so you run it again,
it works
Sometimes you open your fridge,
no food inside, so you close and open it again,
still no food inside12 -
Stop it with the Linux shilling already.
I'm 27 years old and I love Linux and git and vim just as much as the next guy (yeah fuck you emacs!). I have discovered this place as a room for discussion, advise, humor and rants of course, and I had my good share of giggles.
But lately it seems that every other Post is "look at me I installed Linux" or "hurr durr he doesn't use git" or "windows omfg kill it with fire". And to some degree, those rants have a good point and are absolutely right. However, most of them are not.
This is why you're part of the problem. Constantly shaming and ridiculing any technology that's not hip in nerd culture, regardless of the circumstances. This makes you look just as bad as the peoples you look down upon for writing their code in notepad++ on windows xp with McAfee installed. Even worse, from a professional point of view, it absolutely voids your credibility.
How am I to take you seriously and presume a fair amount of experience and out of the box thinking if all you do is repeat catchphrases and ride the fucking hype train. And yes, I know there are a lot of minors or peoples who are just getting started in the industry. But I have seen enough self-righteous hateful spews from peoples who claim not to be.
Anyway, this is getting long and I think I have made my point. Maybe I am just too old to be joking around that shit all the time anymore. But from what I have seen, I wouldn't hire the biggest part of you. Not because you are bad at what you're doing, but because what you say makes you look absolutely unprofessional.
But then again, this is devrant and I love you all. Have a great week everyone!24 -
If y'all need a lil help with clients and conversating, here's my personal way of ending conversations. Just acknowledge it! (If all else fails, take things into consideration)
Friend: I hear that the most viewed youtube video ever is now despacito
> I acknowledge that
*conversation end*
Co-worker: I love my new shoes!
> I acknowledge that
*end*
Hot girl: hey sexy, you're looking fine today
> I acknowledge that
*end*
Client: hey could you add x?
> No
*end*
Sibling: you're adopted
> I acknowledge that
*end*
(Consideration example)
Windows: I will update
> I will take that into consideration
*end*
trogus: I will make a line of debugging ducks with capes with their respective language on it
dfox: I acknowledge that
*end*
Bus driver: sir please wake up the busses are closed
> I acknowledge that *sleeps*
*end*
Python: wrong amount of tabs/spaces
> I acknowledge that *uninstalls python*
*end*
devRant: you are running out of characters for this rant
> I ackno12 -
Watched this movie called Unthinkable where the guy who is supposed to defuse the bomb is typing gibberish into Excel 😂😂😂21
-
A devDuck update!
Hey everyone,
First off, thank you to everyone who has purchased a devDuck (or a bunch!) and thanks to all who have given us feedback. @trogus and I are thrilled at the incredible response these ducks have gotten. If you haven’t seen them yet, you can check them out at https://devDucks.com or the devRant Swag Shop (https://swag.devrant.io).
We are trying to process all of the orders as quickly as possible and our goal is to have all current orders out by the middle of this coming week. Many orders have already shipped, but if yours hasn’t, rest assured it will very soon!
If you ordered a Java devDuck or cape, your order might be delayed a bit until the middle of this coming week because Java seems to be a heavily-demanded cape and we needed to get the material shipped in to make more of that, specifically.
So far we’ve gotten some awesome feedback from the community. A short list of possible future additions based on what’s been requested: Go devDuck, Kotlin devDuck, Perl devDuck, Android devDuck, and possibly some devDuck accessories like little hats, sunglasses, headphones, etc. If you have any other ideas just let us know:)
Lastly, please know that even with the launch of devDucks, we remain extremely committed to the devRant product and we have some very exciting big devRant features coming very soon.
Thanks again everyone!28 -
So I just downloaded devRantron and it's great, it was so easy to install with the .deb file, the website for getting it looked very proffesional and the program itself also look very clean and overall proffesional. The only thing I wish they could have made would be for the boxes containg the rants to be wider, but overall it's amazing!5
-
Teaching 7-8 year olds the basics of web design. We're we're playing with CSS and changing colours of block elements and text. One girl put up her hand, completely confused as to why it wasn't working. Her code:
Section {
Background-color: rainbow;
}
Oh the wonderful mind of children26 -
I went to Paris for my first interview (that was 1989) for a job of Unix kernel developer. All dressed up. I step out of the elevator and see a young punk with scruffy hair and different colour shoes. I reckon he must be the pizza delivery guy. I ask him "dude, can you please point me to the CEO's office for interview". He said "sure, follow me man, I'll show you". We arrive at a desk, he sat down in the big chair and looks at me with a big smile and says "Ok dude, here we are. I am the CEO. Now let's see how good you are!"
I got the job. And 26 years latet, last week, amazing coincidence: I met him again at a trade show in Paris ... with the same coloured shoes. How cool is that!!!29 -
I put an Easter egg into a product, that if you enter the string "final countdown" into the stock code search field, it plays a YouTube vid of Europe's "The Final Countdown", in a hidden div. It's an in-joke for a few people in the company.
A well meaning maintainer with no sense of humour or judgement takes over and goes on the warpath against any hardcoded strings. The secret code gets moved into a config file.
A third developer changes the deployment script so that it clears any configs that aren't explicitly set in the deployment settings.
So the secret code is now "".
Literally every PC in the stock buying department is now blaring out "The Final Countdown" at top volume.
...Except none of them have speakers, so it remains this way for over a year and two more changes of maintainer.
I just noticed this afternoon and quietly re-hardcoded the string. The buying dept.'s PCs will silently sing no more.32 -
Me: 1 is something, 0 is nothing, NULL is the absence of things
JuniorDev: wut
Me: You've got pizza in a box, that's 1. If there's no pizza in the box, that's 0. If there's no pizza and no box, that's NULL.
JuniorDev: OOH so there's no object to reference if I ask for a slice!
Me: *small tear*
Always explain things in terms of pizza. Always.25 -
Sister comes into my room
"Can you look at moms laptop, it stopped working I'm scared I broke it"
Ask why
"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"
Top kek
Take a look
"EFI IPV4 0 (error code) failed to boot"
Weird. Enter bios
"Hard drive: [Not detected]"
Well, that's no bueno
Pop open back, hard drive is loose
Pfft, push that fucker back in
Boot -> works
"Mom is going to kill me I broke it im so worried" -> relieved laughter
Adobeflashplayerkilledmyharddrive.jpg
Shook.exe14 -
So @Linux suggested to make a face revealing rant!
This is the face behind @linuxxx! post yours BUT only if you're comfortable with it :).406 -
This rant is a confession I had to make, for all of you out there having a bad time (or year), this story is for you.
Last year, I joined devRant and after a month, I was hired at a local company as an IT god (just joking but not far from what they expected from me), developer, web admin, printer configurator (of course) and all that in my country it's just called "the tech guy", as some of you may know.
I wasn't in immediate need for a full-time job, I had already started to work as a freelancer then and I was doing pretty good. But, you know how it goes, you can always aim for more and that's what I did.
The workspace was the usual, two rooms, one for us employees and one for the bosses (there were two bosses).
Let me tell you right now. I don't hate people, even if I get mad or irritated, I never feel hatred inside me or the need to think bad of someone. But, one of the two bosses made me discover that feeling of hate.
He had a snake-shaped face (I don't think that was random), and he always laughed at his jokes. He was always shouting at me because he was a nervous person, more than normal. He had a tone in his voice like he knew everything. Early on, after being yelled for no reason a dozen of times, I decided that this was not a place for me.
After just two months of doing everything, from tech support to Photoshop and to building websites with WordPress, I gave my one month's notice, or so I thought. I was confronted by the bosses, one of which was a cousin of mine and he was really ok with me leaving and said that I just had to find a person to replace me which was an easy task. Now, the other boss, the evil one, looked me on the eye and said "you're not going anywhere".
I was frozen like, "I can't stay here". He smiled like a snake he was and said "come on, you got this we are counting on you and we are really satisfied with how you are performing till now". I couldn't shake him, I was already sweating. He was rolling his eyes constantly like saying "ok, you are wasting my time now" and left to go to some basketball practice or something.
So, I was stuck there, I could have caused a scene but as I told you, one of the bosses was a cousin of mine, I couldn't do anything crazy. So, I went along with it. Until the next downfall.
I decided to focus on the job and not mind for the bad boss situation but things went really wrong. After a month, I realised that the previous "tech guy" had left me with around 20 ancient Joomla - version 1.0 websites, bursting with security holes and infested with malware like a swamp. I had never seen anything like it. Everyday the websites would become defaced or the server (VPN) would start sending tons of spam cause of the malware, and going offline at the end. I was feeling hopeless.
And then the personal destruction began. I couldn't sleep, I couldn't eat. I was having panick attacks at the office's bathroom. My girlfriend almost broke up with me because I was acting like an asshole due to my anxiety issues (but in the end she was the one to "bring me back"(man, she is a keeper)) and I hadn't put a smile on my face for months. I was on the brink of depression, if not already there. Everyday I would anxiously check if the server is running because I would be the one to blame, even though I was trying to talk to the boss (the bad one was in charge of the IT department) and tell him about the problem.
And then I snapped. I finally realised that I had hit rock bottom. I said "I can't let this happen to me" and I took a deep breath. I still remember that morning, it was a life-changing moment for me. I decided to bite the bullet and stay for one more month, dealing with the stupid old server and the low intelligence business environment. So, I woke up, kissed my girlfriend (now wife), took the bus and went straight to work, and I went into the boss's office. I lied that I had found another job on another city and I had one month in order to be there on time. He was like, "so you are leaving? Is it that good a job the one you found? And when are you going? And are you sure?", and with no hesitation I just said "yup". He didn't expect it and just said "ok then", just find your replacement and you're good to go. I found the guy that would replace me, informing him of every little detail of what's going on (and I recently found out, that he is currently working for some big company nowadays, I'm really glad for him!).
I was surprised that it went so smoothly, one month later I felt the taste of freedom again, away from all the bullshit. Totally one of the best feelings out there.
I don't want to be cliche, but do believe in yourself people! Things are not what the seem.
With all that said, I want to give my special thanks to devRant for making this platform. I was inactive for some time but I was reading rants and jokes. It helped me to get through all that. I'm back now! Bless you devRant!
I'm glad that I shared this story with all of you, have an awesome day!15 -
So this fucking happened today.
Me: *sees support ticket coming in about some kind of login issue*
Me: *opens issue*
"Hello, I can't seem to login. There's an error"
Me: *sighs and thinks "at least give me that FUCKING error message then." *kindly replies with asking if they could send me the error message*
"Here it is. I don't understand what is going wrong
and what I have to do"
Me: *looks at error message*
"Invalid customer ID. Please make sure that your ID is correct. You can find it in the activation email we sent you when you registered".
😐 😶 😦
Me: *thinking okay what the fuck, are you fucking retarded or something?*
Me: *kindly replies: "It seems that you are not using the correct customer ID. You might want to look for it in the activation email we sent you!"*
"Oh okay thanks, how did you figure that out?"
Me: 😵 😐 😶 😭 🔫
Seriously what the actual fucking fuck.28 -
I recently joined the dark side - an agile consulting company (why and how is a long story). The first client I was assigned to was an international bank. The client wanted a web portal, that was at its core, just a massive web form for their users to perform data entry.
My company pitched and won the project even though they didn't have a single developer on their bench. The entire project team (including myself) was fast tracked through interviews and hired very rapidly so that they could staff the project (a fact I found out months later).
Although I had ~8 years of systems programming experience, my entire web development experience amounted to 12 weeks (a part time web dev course) just before I got hired.
I introduce to you, my team ...
Scrum Master. 12 years experience on paper.
Rote memorised the agile manifesto and scrum textbooks. He constantly went “We should do X instead of (practical thing) Y, because X is the agile way.” Easily pressured by the client to include ridiculous (real time chat in a form filling webpage), and sometimes near impossible features (undo at the keystroke level). He would just nag at the devs until someone mumbled ‘yes' just so that he would stfu and go away.
UX Designer. 3 years experience on paper ... as business analyst.
Zero professional experience in UX. Can’t use design tools like AI / photoshop. All he has is 10 weeks of UX bootcamp and a massive chip on his shoulder. The client wanted a web form, he designed a monstrosity that included several custom components that just HAD to be put in, because UX. When we asked for clarification the reply was a usually condescending “you guys don’t understand UX, just do <insert unhandled edge case>, this is intended."
Developer - PHD in his first job.
Invents programming puzzles to solve where there are none. The user story asked for a upload file button. He implemented a queue system that made use of custom metadata to detect file extensions, file size, and other attributes, so that he could determine which file to synchronously upload first.
Developer - Bootlicker. 5 years experience on paper.
He tried to ingratiate himself with the management from day 1. He also writes code I would fire interns and fail students for. His very first PR corrupted the database. The most recent one didn’t even compile.
Developer - Millennial fratboy with a business degree. 8 years experience on paper.
His entire knowledge of programming amounted to a single data structures class he took on Coursera. Claims that’s all he needs. His PRs was a single 4000+ line files, of which 3500+ failed the linter, had numerous bugs / console warnings / compile warnings, and implemented 60% of functionality requested in the user story. Also forget about getting his attention whenever one of the pretty secretaries walked by. He would leap out of his seat and waltz off to flirt.
Developer - Brooding loner. 6 years experience on paper.
His code works. It runs, in exponential time. Simply ignores you when you attempt to ask.
Developer - Agile fullstack developer extraordinaire. 8 years experience on paper.
Insists on doing the absolute minimum required in the user story, because more would be a waste. Does not believe in thinking ahead for edge conditions because it isn’t in the story. Every single PR is a hack around existing code. Sometimes he hacks a hack that was initially hacked by him. No one understands the components he maintains.
Developer - Team lead. 10 years of programming experience on paper.
Writes spaghetti code with if/else blocks nested 6 levels deep. When asked "how does this work ?”, the answer “I don’t know the details, but hey it works!”. Assigned as the team lead as he had the most experience on paper. Tries organise technical discussions during which he speaks absolute gibberish that either make no sense, or are complete misunderstandings of how our system actually works.
The last 2 guys are actually highly regarded by my company and are several pay grades above me. The rest were hired because my company was desperate to staff the project.
There are a 3 more guys I didn’t mention. The 4 of us literally carried the project. The codebase is ugly as hell because the others merge in each others crap. We have no unit tests, and It’s near impossible to start because of the quality of the code. But this junk works, and was deployed to production. Today is it actually hailed as a success story.
All these 3 guys have quit. 2 of them quit without a job. 1 found a new and better gig.
I’m still here because I need the money. There’s a tsunami of trash code waiting to fail in production, and I’m the only one left holding the fort.
Why am I surrounded by morons?
Why are these retards paid more than me?
Why are they so proud when all they produce is trash?
How on earth are they still hired?
And yeah, FML.8 -
So I got the job. Here's a story, never let anyone stop you from accomplishing your dreams!
It all started in 2010. Windows just crashed unrecoverably for the 3rd time in two years. Back then I wasn't good with computers yet so we got our tech guy to look at it and he said: "either pay for a windows license again (we nearly spend 1K on licenses already) or try another operating system which is free: Ubuntu. If you don't like it anyways, we can always switch back to Windows!"
Oh well, fair enough, not much to lose, right! So we went with Ubuntu. Within about 2 hours I could find everything. From the software installer to OpenOffice, browsers, email things and so on. Also I already got the basics of the Linux terminal (bash in this case) like ls, cd, mkdir and a few more.
My parents found it very easy to work with as well so we decided to stick with it.
I already started to experiment with some html/css code because the thought of being able to write my own websites was awesome! Within about a week or so I figured out a simple html site.
Then I started to experiment more and more.
After about a year of trial and error (repeat about 1000+ times) I finally got my first Apache server setup on a VirtualBox running Ubuntu server. Damn, it felt awesome to see my own shit working!
From that moment on I continued to try everything I could with Linux because I found the principle that I basically could do everything I wanted (possible with software solutions) without any limitations (like with Windows/Mac) very fucking awesome. I owned the fucking system.
Then, after some years, I got my first shared hosting plan! It was awesome to see my own (with subdomain) website online, functioning very well!
I started to learn stuff like FTP, SSH and so on.
Went on with trial and error for a while and then the thought occured to me: what if I'd have a little server ONLINE which I could use myself to experiment around?
First rented VPS was there! Couldn't get enough of it and kept experimenting with server thingies, linux in general aaand so on.
Started learning about rsa key based login, firewalls (iptables), brute force prevention (fail2ban), vhosts (apache2 still), SSL (damn this was an interesting one, how the fuck do you do this yourself?!), PHP and many other things.
Then, after a while, the thought came to mind: what if I'd have a dedicated server!?!?!?!
I ordered my first fucking dedicated server. Damn, this was awesome! Already knew some stuff about defending myself from brute force bots and so on so it went pretty well.
Finally made the jump to NginX and CentOS!
Made multiple VPS's for shitloads of purposes and just to learn. Started working with reverse proxies (nginx), proxy servers, SSL for everything (because fuck basic http WITHOUT SSL), vhosts and so on.
Started with simple, one screen linux setup with ubuntu 10.04.
Running a five monitor setup now with many distro's, running about 20 servers with proxies/nginx/apache2/multiple db engines, as much security as I can integrate and this fucking passion just got me my first Linux job!
It's not just an operating system for me, it's a way of life. And with that I don't just mean the operating system, but also the idea behind it :).20