Another day, another hit piece against gaming.

So, a 15-year old boy hanged himself and the media goes all „This was caused by this game“, even though NO FUCKING TRACES OF THE GAME WERE FOUND ON THE LAPTOP OF THE DECEASED!!!

And then of course my freaking parents go all lecturing me about how the internet twists the brain into not being adequate towards reality etc.

First off, CAN THE FUCKING COLLECTION OF COCKSUCKERS that is the fucking media just fucking get a grip on reality? It was literally said in the same sentence that the supposed game that caused that was not found in any form on the person's laptop. You would think an online game that you take months to play through would need at least some fucking download to run, right? Unless it was a freaking video chat bullshit that they call a „game“ just for the fucking spite of gamers.

Second, HOW FUCKING LONG WILL IT FUCKING TAKE FOR PEOPLE TO FUCKING ACCEPT THAT IT'S NOT THE TECH THAT MAKES PEOPLE KILL THEMSELVES? How hard is it to fucking understand?

Third... How do people in their 60s freaking think they understand anything about modern gaming when they have no freaking way of interacting with it other than these hit pieces? They certainly give more fucks about what a hired bitch of a lying „journalist“, that cannot even talk properly, says. Oh, they care so much about the children. Have they never thought that people are killing themselves exactly because they feel nobody cares about them?

Fourth. How fucking long do parents like mine deny the reality that just as long as they see me as an incomplete copy of my sisters I will be suicidal? Let me guess... It's video games causing me to be oh, so inadequate when I've not played any of them for quite some time...

Fifth... How am I out of touch with reality when these people have never known how I „work“, so to speak, as a person, and they've been the ones basically dictating all my life? Let me see why I'm unhappy...

I know I complain a lot. Sorry for that. But I just cannot stand people like them. People that lie all the time and project that on you while depriving you of any means of defending yourself in a debate...

IF PROGRAMMING LANGUAGES WERE DRUGS:

JavaScript = Methamphetamine:
Anyone can cook some up at home but only pros can make the good stuff without blowing everything up.
Under the influence it tries to do everything at once, in seemingly no specific order before running off and making plenty of promises - but you have no clue if it kept any until it returns.

C = Heroin:
It takes some prep before you can take a hit but when you do it's far more potent than expected. When prepped (compiled) correctly it will induce complete and utter ecstasy but any error or abuse may kill you, leave you on the floor, in a coma or wishing you were dead.

HTML = Paracetamol(Panado):
Some don't think it's a real drug and others do. Either way you should grow a pair and try something a little more hardcore.

--------------------------------------

I came up with these after I randomly explained asynchronous js to a junior as synchronous code on meth. These were just off the top of my head, please feel free to correct or expand on them :-)

Sorry, !dev-related.

Today I wake up tired. Mother barges into my room and tells me I should be already ready, takes time to fucking argue, then does some cleaning(As if I never do it or something), and this evening she starts arguing about that again and just disconnects the plug from my PC, telling me I shouldn't have gotten a person who takes preparing way longer than me and who also got out of the car when I was ready to take off late AND that I should apologise to her for speaking „in a rude manner“, when just a few seconds ago from that she hit me. That hit wasn't painful. It still was a hit, though. Do I have to say how angry I got? As if I needed that. I'm already having trouble with not wanting to kill myself for a whole week nonstop. And she tells me I have to apologise or I don't get my PC back. Oh, I haven't gotten to the best part: My birthday's coming really soon. A week and a day later. Beats me how I will have to force myself to smile like an idiot again just because the actual idiots cannot understand the shit they've done to my mind. So much so I may not be functioning at all if I stay with them much longer.

This combined with all my family telling me how insane I supposedly am etc.

I might try a photography school. My friend(who could be my twin), has been nagging me about trying it...

I need a job.

I need a fucking place away from these blood-sucking leeches.

I need to understand how my horrible self-esteem has potentially fucked my whole life up and how much nerves I wasted on my goddamn nuclear family.

I also need to learn to forgive myself.

Many more, but I will end this here.

woke up at 5am

no alarm clock was required

my fucking passion woke me up to get up and code.

i coded outside in my backyard

felt like cold war

it was night

it was dark

a depressing horror atmosphere

just like my whole life

2 hours later i started seeing sun

it was cold outside. alone. in the dark. my arms were freezing.

but 2 hours later i managed to code the feature. it worked.

3 hours have passed. im ripped. quentally.

doing it here. inside now. started the day happy. dropped bullshit from day before. cleanser of all toxicss.

fuck the past. the past will pull you down and kill you.

this. remember. always do not forget.

I actually hate this job, seems like there's not a single project with decent code abstraction. Everything is a fucking spaghetti like:

```
// we only care about e-mail fields, which are odd
isValid(index) {
if(!(index%2)) {
return true;
}
...
}
```

Like MOTHERFUCKER, WHAT BUSINESS RULE DOES THIS SHITCODE REFLECTS?!?! WHY CAN'T YOU SHITHEADS WRITE PROPER BUSINESS ABSTRACTION RATHER THAN JUST COLLEGE-GRADUATE QUALITY SHITCODE.

FUCKING KILL ME ALREADY I SHOULD HAVE INSTEAD BECAME A PSYCHIC CAUSE I'M SURELY GOOD AT GUESSING WHAT THE FUCKING FUCK THIS FUCKING FUCKCODE INTENDS TO ACHIEVE.

AND YOU CALL YOURSELF TOP-NOTCH DEV CAUSE THIS IS JAVASCRIPT... YOU KNOW WHAT, SHITHEADS LIKE YOU, WHO DON'T KNOW SHIT OTHER THAN GLOBALLING EVERY FUCKING NPM LOCAL PACKAGE IS WHY GOOD ENGINEER LIKE US GET SHIT FROM PHPEPSI ZENDFRAMESHIT FUCKHEADS DEVS.

DO YOU THINK YOUR COMMENT WAS HELPFUL??? DO I LOOK LIKE A BUSINESS GRADUATE FUCKTARD WHO DOESN'T KNOW WHAT THE FUCK THE MODULE OPERATOR IS??? I WANT TO KNOW WHY YOU WROTE THAT SHITFUCK INSTEAD OF WHAT IT DOES; THE REASON I'M READING YOUR POORLY WRITTEN MODULE OPERATOR SOAP-OPERA IN THE FIRST PLACE IS CAUSE I KNOW WHAT IT'S DOING, IT'S BREAKING SHIT.

OH AND ONE MORE THING, FUCK YOU FUCK FUCK FUCKSHIT SHITFUCK FUCk

If programming languages where weapons...

1. C is an M1 Garand standard issue rifle, old but reliable.

2. C++ is a set of nunchuks, powerful and impressive when wielded but takes many years of pain to master and often you probably wish you were using something else.

3. Perl is a molotov cocktail, it was probably useful once, but few people use it

4. Java is a belt fed 240G automatic weapon where sometimes the belt has rounds, sometimes it doesn’t, and when it doesn’t during firing you get an NullPointerException, the gun explodes and you die.

5. Scala is a variant of the 240G Java, except the training manual is written in an incomprehensible dialect which many suspect is just gibberish.

6. JavaScript is a sword without a hilt.

7. Go is the custom made “if err != nil” starter pistol and after each shot you must check to make sure it actually shot. Also it shoots tabs instead of blanks.

8. Rust is a 3d printed gun. It may work some day.

9. bash is a cursed hammer, when wielded everything looks like a nail, especially your thumb.

10. Python is the “v2/v3” double barrel shotgun, only one barrel will shoot at a time, and you never end up shooting the recommended one. Also I probably should have used a line tool to draw that.

11. Ruby is a ruby encrusted sword, it is usually only used because of how shiny it is.

12. PHP is a hose, you usually plug one end into a car exhaust, and the other you stick in through a window and then you sit in the car and turn the engine on.

13. Mathematica is a low earth orbit projectile cannon, it could probably do amazing things if only anyone could actually afford one.

14. C# is a powerful laser rifle strapped to a donkey, when taken off the donkey the laser doesn’t seem to work as well.

15. Prolog is an AI weapon, you tell it what to do, which it does but then it also builds some terminators to go back in time and kill your mom

All credits go to Vicky from damnet.com

I have to let it out. It's been brewing for years now.

Why does MySQL still exist?

Really, WHY?!
It was lousy as hell 8 years ago, and since then it hasn't changed one bit. Why do people use it?

First off, it doesn't conform to standards, allowing you to aggregate without explicitly grouping, in which case you get god knows what type of shit in there, and then everybody asks why the numbers are so weird.

Second... it's $(CURRENT_YEAR) for fucks sake! This is the time of large data sets and complex requirements from those data sets. Just an hour through SO will show you dozens of poor people trying to do with MySQL what MySQL just can't do because it's stupid.

Recursion? 4 lines in any other large RDBMS, and tough luck in MySQL. So what next? Are you supposed to use Lemograph alongside MySQL just because you don't know that PostgreSQL is free and super fast?

Window functions to mix rows and do neat stuff? Naaah, who the hell needs that, right? Who needs to find the products ordered by the customer with the biggest order anyway? Oh you need that actually? Well you should write 3-4 queries, nest them in an incredibly fucked up way, summon a demon and feed it the first menstrual blood of your virgin daughter.

There used to be some excuses in the past "but but but, shared hosting only has MySQL". Which was wrong by the way. This was true only for big hosting names, and for people who didn't bother searching for alternatives. And now it's even better, since VPS and PaaS solutions are now available at prices lower than shared hosting, which give you better speed, performance and stability than shared hosting ever did.

"But but but Wordpress uses MySQL" - well then kill it! There are other platforms out there, that aren't just outrageously horrible on the inside and outside. Wordpress is crap, and work on it pays crap. Learn Laravel, Symfony, Zend, or even Drupal. You'll be able to create much more value than those shitty Wordpress sites that nobody ever visits or pay money on.

"But but but my client wants some static pages presented beside their online shop" - so why use Wordpress then? Static pages are static pages. Whip up a basic MVC set-up in literally any framework out there, avoid MySQL, include a basic ACL package for that framework, create a controller where you add a CKEditor to edit page content, and stick a nice template from themeforest for that page and be done with that shit! Save the mock-up for later use if you do that stuff often. Or if you're lazy to even do that, then take up Drupal.

But sure, this is going a bit over the scope. I actually don't care where you insert content for your few pages. It can be a JSON file for all I care. But if I catch you doing an e-commerce solution, or anything else than just text storage, on MySQL, I'll literally start re-assessing your ability to think rationally.

Sister comes into my room

"Can you look at moms laptop, it stopped working I'm scared I broke it"

Ask why

"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"

Top kek

Take a look

"EFI IPV4 0 (error code) failed to boot"

Weird. Enter bios

"Hard drive: [Not detected]"

Well, that's no bueno

Pop open back, hard drive is loose

Pfft, push that fucker back in

Boot -> works

"Mom is going to kill me I broke it im so worried" -> relieved laughter

Adobeflashplayerkilledmyharddrive.jpg

Shook.exe

I wonder if those people who give unwarranted useless advice to developers go to their doctors and do the same thing.

- Doc, just make a small slit, take out old heart, put in a new one, connect everything back as before and stitch it. Easy peasy. Shouldn't take more than a few minutes.
- my leg is fractured. Just open it and tape it back. It is a hack job, but it'll make the client happy for now. It will be quickly done.
- I think I have cancer. Just write a script to kill it. Shouldn't be too difficult.

Fuckers.

Stop it with the Linux shilling already.

I'm 27 years old and I love Linux and git and vim just as much as the next guy (yeah fuck you emacs!). I have discovered this place as a room for discussion, advise, humor and rants of course, and I had my good share of giggles.

But lately it seems that every other Post is "look at me I installed Linux" or "hurr durr he doesn't use git" or "windows omfg kill it with fire". And to some degree, those rants have a good point and are absolutely right. However, most of them are not.

This is why you're part of the problem. Constantly shaming and ridiculing any technology that's not hip in nerd culture, regardless of the circumstances. This makes you look just as bad as the peoples you look down upon for writing their code in notepad++ on windows xp with McAfee installed. Even worse, from a professional point of view, it absolutely voids your credibility.

How am I to take you seriously and presume a fair amount of experience and out of the box thinking if all you do is repeat catchphrases and ride the fucking hype train. And yes, I know there are a lot of minors or peoples who are just getting started in the industry. But I have seen enough self-righteous hateful spews from peoples who claim not to be.

Anyway, this is getting long and I think I have made my point. Maybe I am just too old to be joking around that shit all the time anymore. But from what I have seen, I wouldn't hire the biggest part of you. Not because you are bad at what you're doing, but because what you say makes you look absolutely unprofessional.

But then again, this is devrant and I love you all. Have a great week everyone!

So, I just got up, opened my sister's laptop to work (she gave it to me while I was in this small trip) and I see this. She was like "if you break it, I'm gonna kill you" and I said "oh no! What am I gonna do? Hammer it or something?" Fuck my luck, seriously

A quite normal Windows day:

Bios to Windows: "Go now! Get up!"

Windows to Bios: "Always slow with the young circuit boards."

"I've got something weird on screen."

Windows' answer: "Ignore it first."

Hardware assistant to Windows: "The user puts pressure. He wants me to identify this thing. Could be an ISDN card."

Windows: "Well, well."

Unknown ISDN card to all: "Will you please let me in?"

Network card to intruder: "You can't spread out here!"

Windows: "Quiet in the case! Or I'll cut both their support!"

Device Manager: "Offer compromise. The network card is allowed on Mondays, the ISDN card is on Tuesday."

Graphics card to Windows: "My driver retired yesterday. I'm crashing now."

Windows to graphics card: "When will you be back?"

Graphics card: "Well, not at first."

CD-Rom drive to Windows: "uh, I would have a new driver here..."

Windows: "What's ich´n supposed to do with it?!"

Installation software to Windows: "Leave it, I'll mach´ that already."

Windows: "That's nice to hear."

USB connection to interrupt management: "Alarm! Just been penetrated by a scanner cable. Request response."

Interrupt management: "Where are you coming from?"

USB connection: "I was in the computer right from the start. I'm joined by another colleague."

"You're not on my list." - "Say something."

Windows: "Hopefully there won't be another printer."

Graphics card: "The new driver twitches."

Windows: "We'll just have to get the old one out of retirement."

Uninstall program to new driver: "Go away."

Unwanted driver: "Fuck you."

Windows to Norton Utilities: "Kill him and his brood!"

Utilities to driver rests: "Sorry, we have to delete you."

Important system file: "Arrrrrrgghh!"

Windows on blue screen: "Gib´, the Norton Boys are over the top again."

Blue screen to user: "So, that's it for this week."

Excuse me for stealing your time

And I know it's way too long

You know side projects? Well I took on one. An old customer asked to come and take over his latest startups companys tech. Why not, I tought. Idea is sound. Customer base is ripe and ready to pay.

I start digging and the Hardware part is awesome. The guys doing the soldering and imbedded are geniuses. I was impressed AF.

I commit and meet up with CEO. A guy with a vision and sales orientation/contacts. Nice! This shit is gonna sell. Production lines are also set.

Website? WTF is this shit. Owner made it. Gotta give him the credit. Dude doesn't do computers and still managed to online something. He is still better at sales so we agree that he's gonna stick with those and I'll handle the tech.

I bootstrap a new one in my own simplistic style and online it. I like it. The owner likes it. He made me to stick to a tacky logo. I love CSS and bootstrap. You can make shit look good quick.

But I still don't have access to the soul of the product. DBs millions rows of data and source for the app I still behind the guy that has been doing this for over a year.

He has been working on a new version for quite some time. He granted access to the new versions source, but back end and DB is still out of reach. Now for over month has passed and it's still no new version or access to data.

Source has no documentation and made in a flavor of JS frame I'm not familiar with. Weekend later of crazy cramming I get up to speed and it's clear I can't get further without the friggin data.

The V2 is a scramble of bleeding edge of Alpha tech that isn't ready for production and is clearly just a paid training period for the dev. And clearly it isn't going so well because release is a month late. I try to contact, but no reaction. The owner is clueless.

Disheartening. A good idea is going to waste because of some "dev" dropping a ball and stonewalling the backup.

I fucking give him till the end of the next week until I make the hardware team a new api to push the data and refactor the whole thing in proper technologies and cut him off.

Please. If you are a dev and don't have the time to concentrate on the solution don't take it on and kill off the idea. You guys are the key to making things happening and working. Demand your cut but also deserve it by delivering or at least have the balls to tell you are not up for it.

Well today I got a fantastic surprise (truthfully). We hired a dev some months ago, who was on 6 months probation and, to put it politely, he was not going to pass it.

*side note: for details of some of the above, read my last 10 or so rants. They are pretty much all him.

Anyway, management put him on an improvement plan to make sure everything was fair, it wasn't working out, but they said we had to finish it to be fair.

So we had another 2 weeks left when he announced last night he's leaving for a new junior role, technical but not a dev.

Months of stress, heartache, bewilderment, late nights and weekends all just came to an end.

The English language fails me to express my overwhelming joy at this moment. The only way I can come close to it is to say that when he made his announcement, a colleague told me I should stop smiling as it could be taken as being rude.

I'd like to take this moment to thank the community for supporting me over the past few difficult months. Without you I probably would have tried to kill him with my dev rant stressball.

Thanks,
practiseSafeHex

🙁

Every girlfriend I had broke up with me and it was not even my fault...

1. A bi cheating on her girlfriend - girlfriend found out
2. Furry cheating on her boyfriend - she felt bad...
3. Hysteric b** that did not trust me for even 1 second
4. Really nice and sweet girl... that could kill me if she did not take her antipsychotics - told me she is sorry but she wants someone older (I am older than her...) - her ex before me was 42....

To clarify: both 1 and 2 did not tell me they were cheating on someone with me... I only found out after the shit hit the fan.

I feel depressed... I just want to love someone and I want that someone to love me... that's it, I don't even want sex, I just want hugs, mutual trust and someone that I could tell anything on my mind without them judging me...

As I was walking to the store, I found yet another piece of evidence of nature rape (aka fucking nature by littering of harmful substances). Just like last time I brought it home for proper disposal.

But if I ever find the motherfucker who did this, I have a nice punishment for you. I'll knock you unconscious, drag you home, take your phone and desolder its battery. Then I'll strap a plastic bag around your stupid face, and put the battery in there while it's being shorted. Quickly it'll heat up and you'll start to turn blue with that little bag being your only oxygen source. And when that battery puffs, boy are you going to fucking gasp it all in. Hopefully that'll be poisonous enough to kill you on the spot. If not, I'll have some fun watching you die from oxygen deprivation. Or I'll jam that very same AA battery that you dropped down your throat - you choose.

Call me a psycho all you want, but what does that make you, whoever attempted to further fuck nature by uncaringly dropping a battery on the sidewalk? Oh and let's not mention the results of it - a heatwave that's been going on for over a month now. Thank you so much for bringing the place that you deserve to be in - hell!

Friend of mine killed his MacBook with some Softdrink.

Just poured it all over his poor a1502.

He let it dry for a few days, it starts to work again.
Except the battery.

Goes on Amazon and buys a new battery.

New battery doesn't work either and so he tells me about it and I as stupid as I am couldn't resist the temptation to finally work on a MacBook like my "hero" Lois Rossmann does.

So turns out the board is good.
Cleaned it up and basically nothing happened to it.

So what's the deal with "los batlerias"?

The first got hit by liquid, the second had a broken connection to a cell.
That could have happened through my friend, installing it without testing it first, or at the seller, so it being a DOA battery.

Now away from the stupidity of my friend and the situation to the actual source for this rant.

Once something happens to a modern Managed battery, the Battery Management System (BMS) disconnects the voltage from the system and goes into an error state, staying there and not powering anything ever again.
For noobs, it's dead. Buy a new one.

But It can be reset, depending you know how to, and which passwords were set at the factory.
Yes, the common Texas instruments BQ20Zxx chips have default passwords, and apple seems to leav them at default.

The Usb to SMBus adaptors arrived a few days ago and I went to prod the BMS.

There is a very nice available for Windows called BE2works, that I used the demo of to go in and figure out stuff. The full version supports password cracking, the demo not.

After some time figuring out how Smart Battery Systems (SBS) "API" works, I got to actually enter the passwords into the battery to try get into manufacturer and full access mode.

Just to realise, they don't unlock the BMS.

So, to conclude, my friend bought a "new" battery that was most likely cut out of a used / dead macbook, which reports 3000mah as fully charged instead of the 6xxx mah that it should have, with 0 cycles and 0hours used.
And non default access.

This screams after those motherfuckers scaming the shit out of people on Amazon, with refurb, reset, and locked fucken batteries.

I could kill those people right now.

Last but not least,
My friend theoretically can't send it back because I opened the battery to fix the broken connection.
Though maybe, it'll get send back anyway, with some suprise in the package.

Dear senior developer with xx years of development experience, please, I BEG OF YOU hear my humble unprofessional opinion.

Not every junior is a inexperienced low life.

Even though I'm glad that I'm working with someone of your wide skill set and expertise, I'm not working with you by choice nor it is my intention to distract or "steal" your knowledge.

When I suggested using a newer version of jQuery for this new project that didn't mean I'm challenging you to work on something new for your domain, I'm merely suggesting this change because jQuery 1.2 is just old and a big portion of it is deprecated.

When I suggest some changes on your CSS selectors that doesn't mean I'm acting out of place, it is my genuine interest of having effecient css where possible.

I know you (in your opinion) are the best full stack developer in the industry, but maaaan you kill me when you use js and regex to validate input type=email (table filp) ... Haalllloooo it's 2017 this Sunday aren't we supposed to progress instead of remaining in the same old same ?

RANT!!!

Note to self: never ever touch the bugzapper that's busy zapping a mosquito! Always remember that there's well over a 1000 volts on there regardless of its power rating. Anything over 50V can kill you!

.. if only my drunken fool self would realize that. Seriously though.. the kick of a bugzapper's shock, it's amazing! Just like drugs however, don't try it at home. Oh well. At least not me but yet another mosquito has bitten the duster. Serves those parasitic bitches right!!!

Wtf, really??? Are they trying to liyerally KILL ME????

Got home from hospital today wth my family. Baby got sick. Wife also caught cold... Bad news. It was just me still healthy like a raddish [we have such saying].
So I got home. Started feeling somewhat funny. Sore thighs, feeling nauseaus, chilly, a bit dizzy.

10 minutes later I'm fucking trembling! It felt as of I was kicked put bare ass to -20C outside! I'm not exaggerating [probably made some typos.. Pls correct me] - i live where winters get like -35C. Everything around got like twice darker. And my lower teeth got itchy af [NOT the best feeling, trust me].

I must have caught cold too - I thought to myself, cuz I know what these sympthoms mean. I always have 'em all when I have fever. Since shivers are caused by rising fever I got my Microlife remote thermometer out of my drawer. Click, blue light, wait, beeep. 36.5C. Allright.. Maybe I got it wrong... Try again -- same result. Wife also gave a couple tries - nada. Nil. Nullpointerexception. Healthy like a pickle!

10 minutes later I couldn't stand the cold. Got under my blankets wife made some soup, tea,... I still have this analog thermometer, the one with quicksilver. Pop it into my armpit - jusyt in case. 10minutes later I take it out. It says 39,5 and rising. Try the microlife again. 36,5. WHAT THE FUCK?????????

If I weren't so fond of old-school stuff I'd be in a fucking ER now!!

Fuck you medical digital equipment made to be used at home! FUCK YOU!!

I'm pissed.

Do you folks kbow where could I get those q-silver thermometers? Just in case. They're already out of matket in my area for quite some time... For being dangerous [i give 'em that, okay?] and.... Lisen to this.... "unreliable"!

FUCK IT!

When the entire platform mysteriously goes down for a half hour at 11pm ON A SATURDAY AND YOU'RE THE ONLY PERSON WHO WORKS ON IT GOOD GOD SERIOUSLY YOU'VE GOT TO BE SHITTING ME I JUST WANT TO SLEEP

WHOEVER DID THIS I WILL FIND YOU AND I WILL KILL YOU

The ultimate "I am vegan" guy will be arch linux user, vegan, trans, crossfitter and cryptocurrency investor. I've just met guy like this in my job. He did not shut up for a while. I am not sure whats he doing and whats his job but my guess is that hes paid for spreading cancer, sucidal toughts and eatig your will to live and talk with people...

R - retard
M - me

R: Hey CopyPasteCode I found this bug, it does 'this' insted of 'this'. *spreads arms to see his "muscles"*
M: *headphones off* Ok, I will look into it... *headphones back on*
R: Btw you invested something in the crypto, didnt you? Ive invested... ...bitcoin... ...crypto... ...litecoin..., do you think that... ...something... ...bla bla bla?
M: *tries not to kill myself after his 5 minutes of monolog* Ye sure
R: By the way Ive found this awesome vegan restaurant that accepts litecoin, would you like to come sometime?
M: *10 minutes monolog about vegan food and shit. At this point I want to die* Ok, I will now work on that back, see you later.
R: ye sure bro (wtf, "bro"?)... *looks like hes walking away* *teleports on my otger side touching my monitor*
WOW you are also a Limux user? 😮 Ivr installed arch linux this weekand and its so awesome, *another 6 minutes of monolog*
M: *smiling and preparing to kill him or myself* Nice, awesome *fake smile*
R: Anyway, I gotta go (FINALLY!!!), btw, I am going to the *name of local trans and gay club*, wanna go with me?
M: *after a month after a breakup with my GF (because she was cheating on me) which everyone in the office knew...)* Not really *trying to thing how to say "fuck off" without having meeting with HR*, I cant, I already have somethimg.
R: Oh, ok. Btw, you are rly cool bro (again), we should hang. We should hangout more often...

I hope someone is paying me for loosing 27 minutes with this guy.

The tech stack at my current gig is the worst shit I’ve ever dealt with...

I can’t fucking stand programs, especially browser based programs, to open new windows. New tab, okay sure, ideally I just want the current tab I’m on to update when I click on a link.

Ticketing system: Autotask
Fucking opens up with a crappy piss poor sorting method and no proper filtering for ticket views. Nope you have to go create a fucking dashboard to parse/filter the shit you want to see. So I either have to go create a metric-arse tonne of custom ticket views and switch between them or just use the default turdburger view. Add to that that when I click on a ticket, it opens another fucking window with the ticket information. If I want to do time entry, it just feels some primal need to open another fucking window!!! Then even if I mark the ticket complete it just minimizes the goddamn second ticket window. So my jankbox-supreme PC that my company provided gets to strugglepuff along trying to keep 10 million chrome windows open. Yeah, sure 6GB of ram is great for IT work, especially when using hot steaming piles of trashjuice software!

I have to manually close these windows regularly throughout the day or the system just shits the bed and halts.

RMM tool: Continuum
This fucker takes the goddamn soggy waffle award for being utterly fucking useless. Same problem with the windows as autotask except this special snowflake likes to open a login prompt as a full-fuck-mothering-new window when we need to open a LMI rescue session!!! I need to enter a username and a password. That’s it! I don’t need a full screen window to enter credentials! FUCK!!! Btw the LMI tools only work like 70% of the time and drag ass compared to literally every other remote support tool I’ve ever used. I’ve found that it’s sometimes just faster to walk someone through enabling RDP on their system then remoting in from another system where LMI didn’t decide to be fully suicidal and just kill itself.

Our fucking chief asshat and sergeant fucknuts mcdoogal can’t fucking setup anything so the antivirus software is pushed to all client systems but everything is just set to the default site settings. Absolutely zero care or thought or effort was put forth and these gorilla spunk drinking, rimjob jockey motherfuckers sell this as a managed AntiVirus.

We use a shitty password manager than no one besides I use because there is a fully unencrypted oneNote notebook that everyone uses because fuck security right? “Sometimes it’s just faster to have the passwords at the ready without having to log into the password manager.” Chief Asshat in my first week on the job.

Not to mention that windows server is unlicensed in almost every client environment, the domain admin password is same across multiple client sites, is the same password to log into firewalls, and office 365 environments!!!

I’ve brought up tons of ways to fix these problems, but they have their heads so far up their own asses getting high on undeserved smugness since “they have been in business for almost ten years”. Like, Whoop Dee MotherFucking Doo! You have only been lucky to skate by with this dumpster fire you call a software stack, you could probably fill 10 olympic sized swimming pools to the brim with the logarrhea that flows from your gullets not only to us but also to your customers, and you won’t implement anything that is good for you, your company, or your poor clients because you take ten minutes to try and understand something new.

I’m fucking livid because I’m stuck in a position where I can’t just quit and work on my business full time. I’m married and have a 6m old baby. Between both my wife and I working we barely make ends meet and there’s absolutely zero reason that I couldn’t be providing better service to customers without having to lie through my teeth to them and I could easily support my family and be about 264826290461% happier!

But because we make so little, I can’t scrap together enough money to get Terranimbus (my startup) bootstrapped. We have zero expendable/savable income each month and it’s killing my soul. It’s so fucking frustrating knowing that a little time and some capital is all that stands between a better life for my family and I and being able to provide a better overall service out there over these kinds of shady as fuck knob gobblers.

What's the difference between a wasp and single loose hair?
Apparently none till the wasp stings :/

Yesterday I thought I had a loose hair on my neck.. ok, I shrug it off.. later again the creepy feeling.. shrugs off..

I continue to work, sumberged in code, wanting to find the fucker (bug, not the wasp/hair).. lean in to the monitor... 10 cents away from the screen... Ok, maybe that's it! Feels the hair on my back, near shoulderblades again... shrugging again more violently to get it further down to fall out.. nothing.. ok, got the bug, threw myslef back in the chair with substential force & BAAAAM!!! Motherfucking hair bit me!! O.o

I scream in horror & on top of the lungs (it was late, after work hours so I didn't expect anyone else still at the office) PROKLETA PRASICA (roughly translated to goddamn female swine).. I previously saw some green bug flying around the office and I thought that nasty thing bit me (didn't know they bite soo, much more horror for me).. O.o

Anyhow, I jump up from the computer and see my coworker looking at me all baffled.. I proceed to franticly take of my headphones and hoodie..thinking about wtf should I do now, I cannot get undressed in front of him (not for my sake, bra is the same as top of the bathing suit for me, but still..I don't want anyone suing me for impropper behaviour of undreasing in front of coworkers..), how the fuck should I get to the toilet?! O.o

C: Are you ok?!
M: Um.. sth bit me..wtf?!
C: There was a wasp flying around somewhere some time ago.. are you alergic?!
M: um..not sure, I don't think so..we'll see soon..

I proceed to the WC, to take off tshirt & check/kill off the fucker.. on my way there (walking funny to not press the hair to my body again) I got another surprise, another coworker was working late..

C2: Are you ok?! O.o
M: yeah, sth bit me, probably a wasp..

Ok, finally on the loo..ok, do not lock self in in case it escapes and you need help.. don't even shut the door. Check.. standing between the doors I contemplate on how the fuck should I take my tshirt off without angering the fucker even more and getting bitten again.. O.O

I lifted the tshirt up my back to let it out.. nope, not there..the creepy felling of buzzing around between my shoulder blades continues.. crap.. what to do?!

I stood there & contemplated the task.. ok, roll up the tshirt to the shoulder blades, not against the body (duh) to prevent further stings..tighten the fabric, so it cannot escape, quickly remove the band from the body.. done..reversed the tshirt and straightened it.. bzzz... Fucker fell somewhere.. Dafaq?! Was it really just a wasp?! If yes, no problem...but what if coworker was wrong and I got bitten by that nasty green whateveritsname bug?! Eeeeewwww! Is it poisonous? Gotta find it & kill it for good.. waited a bit, than saw a goddamn wasp crawl from under the toilet.. wasp!! Yess!! Stopm stomp fucker!!

I get dressed & go back to my desk..

C: Did you terminate it?!
M: Yup, fucker went on a toilet paper trip down the drain!!

I sit down, starting to get my headphones back on and proceed to work.., but before I could, one last gem:

C: CTO would say, thank god it didn't sting you in your finger cuz you wouldn't be able to type anymore..

M: O.O so true hahhahahaaa

Disclaimer - I like animals, but I freakking hate wasps..especially if they get under my tshirt to sting.. :/

If you need to learn/teach object orientation, these are my approaches (I hate that classic "car" example):

1) Keep in mind games like Warcraft, Starcraft, Civilization, Age of Empires (yes, I am old school). They are a good example of having classes to use, instantiating objects (creatures) and putting them to work together. As in a real system.

2) Think of your program as an office that has a job to do, or a factory that has something to deliver. Classes are the roles/jobs and objects are the workers/employees. They don't need to be complex, but their purpose must be really (really, really) well defined. Just like in a real office / factory.

3) Even better (or crazier), see your classes and objects as real beings, digital creatures in a abstract world, and yourself as a kind of god, who creates species (define classes) with wisdom. Give life when it is the time for them to come into the world (instantiate object) and kill them when they are done with their mission (dispose an object). Give them behavior, logic, conditions to work with, situations where they take action, and when they don't. Make them kinda "smart". Build them able to make decisions and take actions based on conditions. Give them life. Think on your program as an ecossystem. There must be balance, connection, species must be well defined and creatures must work together to achieve a common objective. Don't just throw code and pray for it to run. Plan it.

-----

When I talk about my classes like they are real beings, and programs as mini-worlds, some people say I am crazy, some others say that's passion.

It is both! @__@

Proprietary video format. Native iOS app. Ok.

Using swift to decode and render. Ok.
Kills battery and is actually too slow on older devices. Ok..

Diving into armv7 neon assembly, it puts the "ok" in "pleasure".. Ok.....

Getting it to work. Fast frames. Yes. Ok!
Battery still stressed..ok.
Just need to get rid of the brown tint.. ok.

The tint became a brand mark. iPhone gone. Ok! Hours later, received email.

Vendor upgraded to serve h264 over http.
"Kill yourself with fire, ok?"

WTF - I discovered that wasps listen to me!

Earlier when one came in, I tried to catch it with a glass and release it, or kill it if that wasn't feasible. This year, I tried pointing to the window and ordering "get out!" just because I was too lazy to take action. Of course, I didn't expect it to work, but it did. I thought it was only a coincidence, so I kept trying it. It works every single time!

Crazy shit!

Hello again, everyone. I've been busy with all the paperwork at my ship (will make a post about it later) but for now, I'll bore you with another story (not navy one, fortunately) to justify my slacking off.
And this story... is the story on how I got into ITSec. And it is pretty damn embarrassing. It all began when I was 16. I was hooked on battleknight.gameforge.com, a browser game. My father had just had ADSL installed at our home, and the new opportunities before me were endless. Well...
After I've had my fill with the porn torrents and them opportunities dwindled to just a few dozens, I began searching for free games, and I stumbled on that game. I played a lot, but as a free-to-play game, it was also pay-to-win. I didn't have a credit card, so I paid for a few gems with SMS messages. Fast forward a couple of years, I got into the Naval Academy. A guy came in to advertise something (I think it was an encyclopaedia or something - yes, wikipedia wasn't a thing back then) and to pay for it, we could apply for a credit card. So I applied. And I resisted the temptation for a year.
Note: prepaid wasn't that known where I live, so using credit cards was the only way for online transactions.
So I made 1 transaction. Just one. After a couple of months my monthly report from the bank came, showing a 2.5$ (I think) transaction on Paypal. I paid no mind, thinking that it was some hidden fee. Oh boy, I shit you not, I was THAT much of an idiot. Six months later, BOOM!
600$ transaction to ebay via paypal. You can imagine all those nice things that came to my mind. In any case, the bank accepted my protest that I filed at their central offices and cancelled the transaction. I promptly cancelled my card, destroyed it right there for good measure, and got to thinking... what the fuck just happened?
As many people here, I am afflicted with a deadly virus, called curiosity. I started researching the matter, trying to figure out how. And, because I didn't like black boxes and "it is just like it is" explanations, I tumbled down the rabbit hole of ITSec. I soon found out that, not only it was possible, but also it was sometimes EXTREMELY easy to steal credit card info. There are sites, to this very day, that store user info (along with credit cards info) IN FUCKING CLEARTEXT. Sometimes your personal, financial and even medical info are just an SQLi away.
So, I got very disillusioned on many things. But I never regretted it. It may cause me to age prematurely and will kill me of stroke or heart attack one day, but as I still tumble down the ITSec rabbit hole, I can say with confidence that
I REGRET NOTHING
Plus, my 600$ were returned, so look on the bright side :)

Fuck that bitch of a mother of mine. After what she's done to me, I would totally just fucking electrocute her (lawyers, this is a rage post not a real one, I've learnt from that previous psychiatrist that these rages can be taken improperly!) or just send a fucking EMP to her fucking "schermpkes" (EN: screens, displays, whatever! Technology!) or whatever. FUCK THAT FUCKING WHORE!!!

Yes she gave birth to me. Should I be thankful for that, in this world where for some fucking reason Flat Earthers still exist, Despastico and those goddamn fucking Paul brothers became a thing? FUCK NO!! I wish I wasn't born in the first place! Or rather, a thought that's been playing for a long time in my head. Why the fuck can't I just cryo myself and be reborn in the next millennium?! No, that's not possible because as it is now, humanity will likely have fucked up the planet by then. Majority of the people are still no more than self-jerking fucking monkeys. With their Instagram geotagging shit all over the place, nametests and shit like that. FUUUUUUUUUCKKKKKKKKK!!!!!!! Why are people like this?!!!! Why can't people be a tad more intelligent, why can't people actually learn about what this reality is all about?! Why is the burden of all this on scientists, no those who spoonfeed information into the mouths of the masses, like fucking Hashem Al-Ghaili (which is an amazing person but he's doing too much spoonfeeding IMO). WHY?!!! WHY AM I BORN IN THIS FUCKING DYSTOPIA?!!!!

WHY AM I BORN IN THIS FUCKING WORLD WHERE PEOPLE ARE INDOCTRINATED INTO "NOTHING TO HIDE, NOTHING TO FEAR"?!!!!! WHYYYYYYYYYYYYY?!!!!!!!! You've got a fucking brain, USE IT!!!!

I fucking hate this world. Someone hire a hitman on the darkweb to kill me and that fucking whore that gave birth to me, NOW!!!

AM I THE ONLY PERSON WHO READS THE CSS !important RULE AS ACTUALLY SAYING THAT SOMETHING IS _NOT_ IMPORTANT EVEN WHEN IT MEANS THAT IT _IS_?!!

Just kill me.

I jump on an existing scala project.

git pull && sbt compile test

Tests are failing.

Me: "Hey team, the tests are failing."

Team member: "That cannot be. They were passing for the the last run."

Me: "Did you run them locally?"

Team member: "No, on Jenkins. It was fine."

I check Jenkins.

Me: "What do you mean it's fine. The last successful deployment was on the end of May."

Team member: "The Pull Request checker always went through successfully."

I check how our Jenkins tasks are configured. It's true that the Pull Request Checker runs successfully yet due to a "minor misconfiguration" (aka "major fuckup") the Pull Request Checker only tests a tiny subset of the entire test suite.

Team members were were fine if their Pull Request got the "Success" notification on bitbucket's pull request page. And reviewers trusted that icon as well.

They never checked the master run of the Jenkins task. Where the tests were also failing for over a month.

I'm also highely confused how they did TDD. You know, writing a test first, making it green. (I hope they were just one specific test at a time assuming the others were green. The cynic in me assumes they outsourced running the tests to the Jenkins.)

Gnarf!

Team member having run the tests locally finally realizes: "The tests are broken. Gonna fix them."

Wow. Please, dear fellow developers: It does not kill you to run the entire test suite locally. Just do it. Treat the external test runners as a safety net. Yet always run the test suite locally first.

Find a place where management is able to handle some criticism.

I personally think Agile/Scrum is holy, and I don't mean "yeah we kind of do our own version of it", no, fucking do it by the book. The PM shouldn't assign estimates. Developers shouldn't receive bugfix requests from anyone other than the scrum master. The CTO can't be your scrum master... etc.

If a company can't answer the question "What were the points of feedback during the last retrospective(s), and how are those points being picked up?" -- Don't work there.

Many other things are optional in my opinion. I could work at a company without QA, without fruit baskets, table tennis, without Friday drinks. I could even live without git & continuous integration, just emailing patches to a patch integrator. I don't care.

But maintaining a safe bubble of serenity and sanity for devs to do their work in, that is an absolute must.

Also, option to WFH as much as wanted. Offices are nice for social bonding, but they kill productivity for me.

I used to think Electron apps were gonna do great and make it more accessible for companies to produce high quality programs with ease.

Oh boy I was wrong. All it did is enable big companies with the ability to refactor all of their software to run 5 times slower, consume 10 times more memory and kill your battery 20 times faster.

I fucking hate all of this prototype fast optimize later bullshit. Can I get some value for my dollar? How come technology is just being degraded for the same of "ease of programming".

You save programming time but sacrifice end user time, cus our time just doesn't fucking matter.

Shit! I knew buzzwords were overused, but I just saw an ad and it is fucking jesused jambled bananas in the ass.

Starts with a woman looking out the window and there’s a tornado (seems ok for now)

The tornado approaches and IT IS MADE OF FUCKING NON MONOSPACED IN MY ASS FONTED 0s AND 1s. Bonus point: they are green !!

Switches to lines of GREEN code (kill my fucking brain with a pistol attached to your dick right now)
Probably JS or something similar in syntax.

And then: A FUCKING GUY LEANING OVER POINTING SOMETHING ON THE SCREEN! HIS NAMETAG:

Logan Paul
Blockchain

👏👏👏👏

And then some other buzzing asses armagedon en d of the fucking world bleeding edge vibrator buzzwords shenanigans.

Finishes with drones shot flying between businesses building with 3d floating words like

Blockchain!

Artificial Intelligence

Deep learning

Etc.

KILLLLLL MMMEEEE FU748-KFJV ING 3I6HT N0W $)&(&($8#;&(&8 jeiebc

First of all, I hate crammers so much. These people kill the industry without even understanding it. They turned interviews into exams, missed the point of hiring, and saw no distinction between knowledge and information all the time. They don't understand that if you can google an answer in five seconds, it's not knowledge. It's information.

They don't understand that questions like 'what will Python do if you delete an item from a dict while iterating over it' are complete nonsense. They don't understand that it's not 'dig deep'; it's just a bad practice that leads to errors, thus must be avoided. The fact of remembering 'RuntimeError: dictionary changed size during iteration' means that you haven't been avoiding it enough.

One more example. Which signature is correct?
- ApplicationListener<ContextRefreshedEvent>
- ApplicationListener<ContextRefreshEvent>
- ApplicationListener<RefreshedEvent>
- ApplicationListener<RefreshEvent>

Second. What's the point of forcing you to write compilable code in google docs? Do they really expect that one could possibly remember 'import org.springframework.beans.factory.annotation.Autowired;'? Seriously?

Third. Why do they expect me to know Spark, Java, J2EE, Spring Boot, Python, Kafka, Postgres, React/Redux, TypeScript, and work for miserable 70K EUR?

What's wrong with the European IT job market? Are they fucking nuts?

First I wanna say how grateful I am that devRant exists, because my friends either don’t understand this vocab or don’t care lol.

Last week I worked on a pretty large ticket, opened a PR with 54 file changes. Just to follow standards I set the PR milestone to a future release version, but the truth is I didn’t care which version this work ended up in— I just needed it to go into the develop branch asap.

Since it was a large PR there was some expected discussion that prolonged its merging, but in the meantime I started a second branch that depended on some of the work from this branch. I set the new branch’s upstream to develop, fully expecting my PR to merge into develop, since that’s what I set the PR base to.

I completed all the work I could in the new branch, and got two colleagues to approve the initial PR so it would be merged into develop, I could add the finishing touch and get this work done seamlessly before the week was over. They approved, it got merged, I pulled develop, and… my work wasn’t there. I went to look at my PR and someone had changed the base branch to a release branch. It was my boss, who thought he was helping. (Our bosses don’t actually work on the same team as us, so he didn’t know. it’s weird. We have leads that keep track of our work instead.)

I messaged him and told him I really needed this in develop, knowing our release branch won’t be in develop for probably another week. I was very annoyed but didn’t wanna make him feel too bad so I said I’d just merge the release branch into my new branch. So many conflicts I couldn’t see straight. His response was “yeah and you’ll probably have a bunch of package manager conflicts too because that’s in that release.” He was right— I have so many package manager conflicts that I can’t even see how many compiler conflicts there are. I considered cherry picking my changes, but the whole reason I set develop as my upstream was to avoid having any conflicts since I’m working in the same functions, and this would create more.

So I could spend the next (?) days making educated guesses on possibly a thousand conflict resolutions, or I can revert my release branch merge and quietly step back and wait for the release branch to be merged into develop.

I’m sure cherry picking is the best option here but I’m genuinely too annoyed lol, and fortunately my team does not care to notice if I step back and work on something else to kill time until it’s fixed automatically. But I’m still in dire need of a rant because my entire plan was ruined by a well-meaning person who messed with my PR without asking, so here is that rant and I thank you for your time.

Teaching new recruit some SQL (even though hes supposed to fucking know SQL and have multiple years experience but I was a contractor and idgaf, not messing up my money. Just fucking annoying to have an idiot around you all the time).

Me: Okay, so sys tables, so this one is for jobs yeah?

Him: Yeah

Me: Okay, so in this table, its obviously not one row per job per step cos you have multiple rows for the same job and step. Also, there is a datetime field, so what is it showing?

Him: Hmmmmm..... (after some time, back and forth we get to the answer).... history table

Me: Cooooooool, okay, so, lets say, I have a job with 5 steps. If i run it once, how many rows will be in this table?

Him: 5 rows.

Me: Correct, so if I were to have run this same job, 10 times, how many rows get inserted into the table?

Him: (Now...you have to understand, how long this thought process was, im trying to fill the gap with words but really, he was like, having a flashback or something...I kept quiet but silently wanting him to say anything....then he looks me dead in the eyes).... 10!

Me: Motherfucker what!?!? 10 What? If 1 time == 5, what does 10 times ==?

Him: Hmmmmmmmmm.... (yes...we are doing this whole flashback montage all over again)....... Ohhhhh, 1!

Me: .....Stop, think, its a history table. It holds history, for when every step is run for a job, why would it be only one row?

Him: OMG, I know what a history table is!!!!

Me: (Pissed off cos I don't take disrespect calmly). Fine, genius, answer, go!

Him: (LONGER WAIT THAN LAST TIME!!!!)....is it not 10?

Me: I swear, I'm gonna kill you one of these days.

Him: *chuckle*

Me: No...seriously....

TOOK 20-30 MINUTES FOR HIM TO SAY 50!!!!!!

And even then, I swear he didn't understand why. Serious, he was a special breed, had a manager that was a super tard and when I worked here, the spirit of that manager possessed this idiot, the CIO and his little right hand bitch zzzzzzzzzzzzzzzzz.

If there was ever a time I was willing to catch a case at work, it was there.

Bonus: Serious, it got to the point I had to come in and tell this idiot that he can only ask me questions today if he calls me by my name...and my name has changed today...and no, you can't ask me for it cos you need my name to ask me questions.....FUCK OFF kkthxbai.

> dockerized gitea stops working 502,
> other gitea with same config works just fine
> is the same config the issue? maybe the network names can't be the same?
> no
> any logs from the reverse proxy?
> no
> does it return anything at all on that port?
> no
> any logs inside the container?
> no
> maybe it logs to the wrong file?
> no others exist
> try to force custom log levels
> ignored
> try to kill the running pid
> it instantly restarts
> try to run a new instance with specifying the new config
> ignores config
> check if theres anything even listening
> nothing is listening on that port, but is listening in the other working gitea container
> try to destroy the container and force a fresh container
> still the same issue
> maybe the recent docker update broke it? try to make a new one and move only necessary
> mkdir gitea2
> all files seem necessary
> guess I'll try to move the same folder here
> it works
> it is exactly the same files as in gitea1, just that the folder name is different
>

Shit morning, I work in tech, so I guess it is related haha.

First, I wake up and it is cold. Like -12 degrees Fahrenheit. With wind-chill, feels like -29 according to Google. Then, while getting ready for work, my only belt breaks. Not a little, but literally splits in half! Fucking sucks, as my pants keep partially falling down and my shirt keeps untucking.

I go out in this cold that could kill a polar bear, go to start my car. Can you fucking guess? Dead fucking battery. Fuck! Now I am super late to work.

Make it to work, and guess what? My manager just promised 100% completion by Friday, and we are weeks behind! Fucking sucks... I think my coworker snapped, as he keeps hyperventilating at his desk for no reason. Oh and our best coder just quit...

Waiting to either wreck my car or find out my dog is dead when I get home...

Today I saw a code written by my junior. Basically excel export. The laravel excel package provide great ways for optimization.

My junior instead did 6 times loop to modify the data before giving that data to the export package. We need to export around 50K users.

When I asking him why this ? He said it works and it's fast so what the issue ???

Noob , you have only 100 users in the database and production has 10 million.

Sometime I just want to kill him.

rant, but not an IT kind... okay, maybe not even a rant, more like depressive rambling:

in 3 days, I'll turn 29.
i'm living with my mom, in the apartment where I was born, in the room i've been living since I was born (with the exception of 2 attempts to move out which together lasted 9 months).

my theoretical monthly income should/could be around 4000€, based on my skills and experience.

but I'm a (manic)-depressive, chronically lonely idiot loser (and the manic phases come more and more rarely in recent years), so
my practical average monthly income fluctuates from 0 to about 200.

i am unable to keep a job for more than 4 months, so after being fired from about 20 or so of them since I was 18, it takes immense amounts of mental and emotional energy to even start looking for one now... so I usually don't.

i've been about 12000€ in debt for the past 8 or so years, half of which is just debt collector fees.
it's kinda funny, for years, i've been unable to solve a debt which theoretically amounts to 3 months of my theoretical achievable salary.

my father, who just left without a word of explanation when I was 18, has decided this is not viable anymore, so I'm supposed to move out by 10th of next month, "either to some cheap rooming house, or under the bridge, I don't care", as he put it.

I can't remember how it feels to exist a single hour without feeling existential dread and dreading each next day, not knowing what to do or if i'll even be able to try and do something, because this feeling is so strong that it often blocks me from being able to do anything. i just shiver most of the time that i'm awake, feeling like you feel few minutes before puking and crying at the same time. and that feeling is my "how are you?", "you know... normal".

i can't remember what it feels to feel any other way and can't even imagine it, and can't imagine that I'll ever achieve any less shit feeling.

literally all of my social contact consists of going out once to twice a month with the only 2 friends and 2 aquaintances I have who have the time and will to spend it with me.
oh, and hiding in my room, avoiding talking to my mom, because each time we talk she just reminds me what a piece of shit failure I am, and tells me how it's not that hard to change it, I just have to stop being lazy and start working for it.

she's... kind and caring about it, which somehow maybe makes it even worse.

i have about 10 almost complete game designs, each of them at least 50% more original and interesting (at least to me) than the things that are coming out for the past 10 years, being lauded as "the most original and unique".

I have been trying to make them, ANY of them, since I was 18, but I always lose all the drive and resolve and energy in like 4 months, because it's like trying to build a city on my own on a deserted island. too big for one person, but there was never anyone to help me. closest I ever got was one of my friends telling me "i've been thinking many times that i'd love to work on some project with you, if I had the time".
and second time, when I actually found an artist I was going to pay, and he was awesome, and after two weeks of me telling him how awesome what he does is and how it fits the project and my ideas perfectly, he backed out saying "i'm afraid I can't do the quality you require from me".

never ever in my life did I get actual help with something I actually wanted or tried to do.

i have no idea how it feels to have someone working with me on something I actually consider interesting and meaningful, on any of the things which I wanted to make, which made me learn programming.

I've learned graphics and animation and everything going into game making pipeline on my own because I realized nobody will ever help me, so I'll have to do all of it on my own.

I've tried to make a kickstarter once, but I started crying hysterically in the middle of writing it, because I felt like a begging piece of failure shit, even more than usual, so I deleted it.

most of people treat me like shit failure unworthy and undeserving of living, precisely as I myself know I deserve to be treated, because that's what I am, but when I ask for permission to kill myself, since I see no other solution to stop being a burden, they get angry at me that I'm just emotionally blackmailing them. when I afterwards ask them "so help me in any way to do any of the projects i want/need to do", they respond they've got no time for that.

when I talk about all of this, I get told to stop whining.

happy 29th birthday, me, a piece of shit who should've never survived this long, who should've never been born in the first place.
yay.

also, I know this is not the kind of crap that's supposed to be posted here, but i've got nowhere else. sorry.

Okay, just wrote a program with memory allocation inside an accidental infinite loop and by the time I was able to kill it, it had already claimed 86% of my memory. Scared the shit out of me because my OS was CRAWLING for a while

Guy: - "Your restart script doesn't work."
Me: - "What do you mean?"
Guy: - "It does nothing."
Me: - "It should kill every processes that's running within the project and start them again. Wait... Why do you terminate it?"
Guy: - "I don't. It just stops."
Me: - "It says `Terminated` here. You killed it. Just let it do it's job, don't kill it."
Guy: - "I'm not killing it! It just stops!"

(...two hours later...)

Me: - "Wait... Where do you run it from?"
Guy: - "What do you mean? I just run the script you gave me."
Me: - "Yeah, but where do you run it from? Where did you put it?"
Guy: - "It's part of the project so I put it in the project, d'oh!"

PSA: if, for whatever shit reason your brain comes up with, you decide to run a webminer in your retarded useless piece of shit website, at least HAVE THE DECENCY TO WARN USERS ABOUT IT. And while you're at it, implement some basic monitoring and safety functions. If you don't, you can set yourself on fire and jump from the top of the tallest building you can find.

Some basic tips:
1) don't run that shit on phones. The fraction of a fraction of a cent you're gonna earn from them is not worth the risk of overheating them and draining their batteries.

2) add low battery/overheating protection: the last thing you want to do is kill some poor sucker's laptop (and potential unsaved work) just because they forgot a tab open. Every time a laptop dies because of you, a knife will slit your throat.

3) WARN YOUR USERS ABOUT IT! You are straining someone else's resources for your own profit: at least have the balls to be open about it. If you try to run a miner silently in the background, I will make you eat whatever is left of your fucking brain, then drown you in the shit that comes out of your ass.

!rant but nightly thoughts about wrecking clients that won't pay

If you're building something for a client for money, think of a killswitch.

If it requires internet anyway and you have a webserver, do something similar to what the killswitch of WannaCrypt was (but rather checking for a file on the webserver for existing/non-existing). If the client won't pay, kill the application. If the client pays, maybe even deliver a version without killswitch later (as a "bugfix")

If it is some offline project, you can check for a date (payment due date?) and also check for date/time manipulation on the system itself, and disable the killswitch via a "bugfix" version later just like above.

If clients pay, they don't have trouble. Else, they do.

My worst experience is, that I was fired after the third week in a new job. I worked then for a really small company.

My supervisor didn't like me and just wanted me out.

He asked for feedback and new ideas. I provided good reviews.

I even gave the company really good ideas, didn't get any credits for it, but they have implemented them now. Never got any credit for it.

I can look back and say that my supervisor then was a douche and wanted to kill off a young guy with a bit more technical knowledge and a vision.

For me it's in the past...

Now I got a way better job at a really gigantic company, better pay, much better work with better working times, a very friendly and helpful team, which appreciate my feedback and effort.

Sometimes it needs to get worse, to have later something better.

Now I can enjoy my new job and go everyday with a smile in my face :)

Google can you fucking not just kill off random projects that still have a very active userbase!!!
I know you want to merge the play music streaming with youtube music. But that is no reason to kill off the default music player on Android. Cause, y'know, A FUCKTONNE OF PPL STILL USE OFFLINE MUSIC!!!!
And to add more insult to this, Play Music is a default app on pretty much all Android phones. This means it cannot be uninstalled at all. (Unless you root) So thanks for the waste of space!!!

Rant about a german problem in english

I think we as the people should just sue the german government for neglect of progress and neglect of the education system. If your not familiar with the state of german IT we have worse internetspeeds than uganda or the notoriously shitty australia, our neighbourstates look at us in disbelief while laughing in optic fibre. Our school system seperates all students after 4th grade in 3 tiers, the lowest one gives you the future perspective as a social security case. The second and highest tier require masses of useless knowledge, so called "competences"(Kompetenzen) which are totally useless skills with no real world application because they are derived from real skills, a median ground between all possible applications of that skill. And while doing that they terribly insist on doing everything the "proper" way, meaning handwritten. Most people you would expect to have basic computer literacy, meaning age 40 and below, are incapable of using basic functions of a non-smartphone computer and do not understand the slightest of what they are actually doing or supposed to do. And I mean nothing technical. Germans are the reasons they still put word as a job requirement for devjobs because this disqualifies half of our population. This leads to many people having the archaeic "we versus the machines" mentality, thinking that if they ever let the computer do parts of the job, they will then lose all of it to the machines. Thats why you never strive past basic mathematical principles in mathematics, which is a big misnomer because you never do actual mathematics, only calculating and basic calculus and statics. If you get to use your calculator, its some basic casio with no actual functionality then standard operations. And even using that is shunned upon. How is this country ever supposed to become something more than it was in the 90's, if we teach people nothing of use and kill all progress in its root.

Where I work we develop drivers and command-line software for embedded systems. The contracts we have with our customers tend to be in the £100k-£500k range and are usually completed in 6 - 9 months; our team is made up of 20 developers. You would think that it would be worthwhile investing in the department. But no, instead we have to deal with >10 year old build servers on their last legs; limited numbers of development boards with wires soldered on so that we can keep up with new board revisions; no room for R&D into new products; and to top it all off, not one of the executives has a laptop on par with the placement students in the next department. It's like the company is trying to kill the department, we've seen our staffing dwindle with no new graduate (or higher) positions being made available in the last 3 years while we've lost at least 5 people to other places. I just don't get it!

In the last project i worked in, the product owner wouldn't treat people as people but as resources.

The problem with that is you just look at people and their work in terms of a checklist and remain blind about real humans face.

She wouldn't understand the challenges of building something with an absolutely new stack which people needed to learn from scratch and put pieces together. She wouldn't be supportive of people trying out things and fail.

One fine day I told her that I was spending too much time on meetings and i should be excluding that time from available sprint timings.. she made me open my calendar in a screenshare session with all team members. Made me go through go through every meeting invite i had on calender and ordered which ones should i be attending from then and which ones i wont. That was insulting. It broke the trust.

I decided to not work with the project. Stopped putting my heart and soul into it and eventually got out of it in a month time.

Don't put your team into a position like this ever. You have to trust them with the problems they face and try to find a solution. Scrutinizing and micro management will always kill the team.

TL;DR
I accidentally surpassed(?) my user permissions and closed some of my classmates browsers and locked up a terminal for me

In school we have 2 primary operating systems: Windows and Ubuntu. Windows is hell in general and but not as hell as the firefox installation on Ubuntu.

"Just loaded this page. Now wait half a minute so that I can render it"
"Woah, woah, woah. Slow there. You just made an input event. Give me those 5 seconds to compute what you just did"

Executing "top" or "htop" shows you a long list of firefox processes with a cpu usage of 99.9%, since the whole school shares that linux environment.

Anyway, one day it was way more servere than normally and I way forced to kill my firefox instances. So I pressed CTRL+ALT+T for that terminal, waited 5 minutes until it accepted input typed "killall firefox" with a delay of half a minute per character and smahed that enter key.

At this very point in time I could hear confusion from every corner of the room. "What happened to firefox?"

Around 30% of the opened browsers where abruptly stopped. I looked back to my screen noticed I was logged out. I couldn't login from that terminal for the rest of that day.

Our network admin, which happened to be there, since the server is just next door, said that this was just convenience, but the timing was too perfect so I heighly doubt that.

I felt like a real hackerman even if it was by accident :)

Six years ago I created a drupal page pro bono for an organization I'm in. Was my first site really, was hacky af, in retrospect, I created an unmaintainable monster. And as it usually happens, I moved away, the site stops being properly maintained, opening admin view just cries "please update me" (or was it "kill"? Not sure here). Now I'm back in town and get a call from the current one in charge requesting a training. I thought this evil dark dev history of mine is now finally returning to hunt me forever. But no, she actually understood it, and after half an hour she was perfectly capable of maintaining the site. I'm stunned.

The more I use Go, the more i start to like it. I didn’t realize how nice being able to generate binaries for every OS that matters was, until I had that power. It beats the hell out of trying to distribute a Python app for sure.

Sure, it has its warts.

It’s overly bureaucratic in the same way Java is.

I hate that you can’t import something without using it (most people I’d wager preemptively import libraries they know they’re gonna need even if the code isn’t written yet)

I really wish there was a way to just say “See this JSON blob? All those keys and values are strings, trust me, you don’t need me to tell you the type of each one individually.”

Generics would be nice.

I’d kill for exceptions - any decently sized go program is going to have very many if err checks where most could be condensed down to a single try/catch in most other langs.

I wish the tooling was better. Dependency management was a solved problem when Go was released and yet they chose to ship without it. There’s still no standard. Many hours of time have been wasted dinking with this.

But ya know what? Even with those warts, it’s still easier to write than Java. It’s still write once run anywhere, it’s blazing fast, and doesn’t require your end user to install an entire freakin runtime.

<3 Go

When working with hardware some mistakes can be literally painful. Thankfully this was all during undergrad and I'm only around computer hardware now lol.

>Misprogrammed a software kill switch so a sensor that should not have been sending data was actually sending data which caused the system to activate a piston that went WHAM! into the face of a teammate working on replacing some part of it...

>Misprogrammed a controller so it drew too much power from the supply and the puny supply wires literally burst into flame and fell across my arm.

>Spun a 9000rpm CNC spindle the wrong way and caused an attached screw to go rocketing upwards instead of downwards and almost break the (pretty expensive) thing (uh...we were trying to use it as a power screwdriver essentially but I set the rpm to about 100x what I wanted and the direction wrong so yeah).

>Switched a -1 with a +1 in a robot's control system sending it careening into a teammate's leg... let's just say mecanum wheels are paaaainful.

"As it turns out, this world isn't all that complicated. It's pretty simple actually. It's all a game, a very simple game. Of course, some will try to make it difficult. But you can handle them, I know it. I know you can!"

There's a lot of truth in that. When you get into the depths of how the world works, things turn out to be pretty simple.

One thing I cannot rationalize though. The human spirit. The desires that it embodies. I've had this question for so long - what makes us humans human?

If for example a future surgeon - able to exchange individual cells between me and you - would do so, at which point do you become me, and the other way around? 50+% exchange? But that'd mean that at least part of me is still "you". In that state, are you truly you?

Not sure what the cellular definition of an individual is, given that we're headed towards a bionic society where synthetic organs will likely become more relevant than the donated parts of me that I've recently applied as a donor for. I wholeheartedly encourage that future, but the philosophical questions that surround it become more relevant.

How about the impact of influencers on the mind? For example, I've seen the term "certified enganeers" become a trend here, which I'm very grateful for. It does raise a question though. If for example I were to die, would the term live on? And if so, is that a part of what makes me "me"? Would a part of me live on in you? Would your spirit be partially me, due to mere influence?

What makes up the human creature anyway? I think of my own body as a mere vessel for my mind, but I can't quite grasp what makes up the mind, and philosophical questions like "if I were to upload my mind to a robot and instruct it to kill me, would that carbon copy become *me*?"

The human nature is such a weird thing.. and technology doesn't make it any simpler. Is it really just a simple game, with simple rules and e.g. a biological program running inside of a biological motor? Or is there more to it?

Just got a warning email from OneDrive saying my account would be frozen soon because I had used 28.1Gb of my alotted 5Gb...

Erm... First off, I do not use OneDrive. I use Google Drive and JottaCloud. I have actively tried to get RID of OneDrive in Win10, with all those damn notifications all the time.

Secondly, I guess it's nice that if you DO use OD and hit the limit, they don't just cut you off instantly. But nearly 500% overuse seems a little late to react, no?

So I logged in and looked around to find out what the hell was in there. Turns out, MS had decided to upload my entire images folder. I did not ask them to do that. Deleted them, but will have to check the damn OD service when I get home so I can KILL IT!

And I am going to have (yet another) talk with MS support as well, I think...

I really hate fucking Wordpress!

I hate it's stupid API, with it's stupid hooks and actions and all those stupid functions and no fucking logic to any of it!

I hate it's stupid plugin system, with all that fucking overhead that brings no real value and adds all that complexity for nothing!

I hate stupid fucking multiple calls for the same fucking assets, loading them over and over again because every stupid plugin calls them again and again!

I hate motherfucking SHORTTAGS, or whatever the fuck they are called!

I hate that every stupid fucking plugin and shortcode and fucking every little fucking piece of HTML comes from a different fucking place, with different fucking structure and different fucking classes and stupid fucking loading seaquences that make no fucking sense!

And I hate fucking page builders !!!!!

Fuck!!!!

I should be fucking coding on this fucking peace of shit, but I just cannot fucking take it any more!!!

IT NEEDS TO FUCKING DIE!

It should be relegated to the darkest corners of the internet and all the servers that have it's fucking code anyware on their systems should be disconnected and buried in the deepest pits of hell, just to be sure it never, EVER, surfaces again!!!

AAARRRRGGGHHHHHHH !!!!!!!!!

OMFG! Who’s bright fucking horrible stupid ass idea was it to mix Ajax with php (php deciding the ajax paths) with random js outputting HTML inside random fucking static divs found no where near the logical route of content.

Trying to add a simple fucking status to a gigantic cluster fuck of a legacy project is just FUCK.

If I could I would burn this bitch to the ground and start again I would, But no, it’s needed.

Someone kill me before I break the shit out of this thing, I would take a wordpress project right now instead.

I'm going to kill management.
After a serious migration fiasco at one of our biggest costumers the platform was finally usable again (after two days instead of 10 hours) and, of course, users started to report bugs. So good old po came in ranting that we as qa did a horrible job and basically tried to fault us for a fucked up update (because we produced user pain, which of course not being able to log in didn't do). Among the issues: If the user has more than a hundred web pages the menu starts looking ugly, the translation to dutch in one string on the third submenu of a widget doesn't work and a certain functionality isn't available even if it's activated.
Short, they were either not a use case or very much minor except for that missing function. So today we've looked through the entire test code, testing lists, change logs and so on only to discover that the function was removed actively during the last major update one and a half years ago.

Now it's just waiting for the review meeting with the wonderful talking point "How could effective QA prevent something like this in the future" and throwing that shit into his face.

I mean seriously, if you fuck shit up stand by it. We all make mistakes but trying to pin it on other people is just really, really low.

Fuck. I can't take this shit anymore.

There was a project where we had to implement third-party system for government agency processes management. For some reason, probably because my work is cheap for my boss, the task was assigned to me. Just as a reminder, I'm a .NET Dev. Zero experience in server management. Zero experience in external services implementation.

Anyway, system producent, also an government agency, got angry, becasue they can only earn money on implementation. They have to give the software to other agencies for free. Because of that I've got client program, incomplete documentation and broken scripts for database creation. It took me 2 months to get it all to work but at the end client was happy, my boss got paid and I've got 500 PLN (~130 USD) bonus.

Everything was fine for a while, but after a month server has started freezing everyday, some time before 7 am. The only way I found to make it work again was to restore snapshot made everyday at 10 pm. For a month I was waking up earlier and restored snapshot, and after that my boss took it upon himself. I tried few times to find a bug and fix it, but to no effect. Even person with much more experience with it tried to help but also couldn't find anything.

My solution? Copy all the data and configuration, create new machine, copy everything and check if the problem persists. If not, kill old server. Client won't even notice. But nooooooooo... It would cost my boss a bit of money and I'd need to work on it and he can't let it be, because I'm the only developer working on his flagship product. He'd rather wake up everyday and restore snapshot. Okay, as you wish.

And today, finally, everything went downhill. Snapshot wasn't created, server froze, backup can't be created. Nothing can be done. Client is furious, because they have had reported this problem and a few times restoration was too late and they couldn't work. No one knows how to fix it, I'm not working today (I'm still studying and am available only 2 days) and situation is really shitty.

BUT SURE. ITS BETTER TO RESTORE SERVER EVERYDAY THAN JUST FUCKING FIX IT.

Oh, also, there's no staging or any other real backup. We have snapshots for each day and that's that. Boss' order. Why do I even care...

The codebase I'm working with hss rarely comments on it. But when there are comments written they are shit like:
//Kill Matt

//don't ask me where that hard-coded value came from, it just works

//we have to add the elements to the fucking list

Reeeeally helpful. Yep.

Client: I want a new feature for my chat bot. It should be able to rap.
Me: ... k
*monologue: wait u w0t m8*
Also me: Can you please go more into the details? It should be able to rap. Ok. But how do you want it to look like? How "strong" should be the discrimination level, for instance?
Client: It should beat ass, yo.
Inner me -> core me: Let us just ignore him. We won't be able to do it, since he isn't really explaining his needs. "It should be able to rap". We are not wizards.
Core me -> inner me: Chill. We will just use some insult apis, combine it with cleverb0t api et voila.
Me: Alright. I got an idea for it. I can do it within this week. And if you don't like it, I will ofc do some changes to it.
Client: Hmmm... that's nice and good. But within 1 week?
Inner me: I can't do magic and pull that feature out of my fucking ass!

Clients... clients... clients...
0. Don't expect us to be done in a few days. We are also humans. And not fucking machines.
1. Do us (all devs on planet earth. -Microaggression in 3, 2, 1..) a favor and (kill yourself) learn how to request a feature.

Wow, I just realized the marketing teams of most of the companies I have been dealing with are some cold sociopaths.

Every other letter that pops in the mailbox is filled with dark patterns trying to guilt me into opting in to their continued spam:

Subject: Most awesome husky puppy!

Look at this beautiful husky puppy. Isn't it beautiful.... It would be sad if something happened to it... But I am afraid... Something will happen to it...

If you don't opt in to our email message... I am afraid we have no choice... We have to kill this puppy. End it's life... We have no choice. I wish we did! Nothing would please us more than keeping this beautiful-beautiful puppy living and playing....

But if you don't opt in... We have to cut it's throat. Leave it lying on the ground, bleeding out as the life slowly fades away from it's pretty blue eyes...

And Remember: it's not us who killed it... IT WAS YOU! YOUR ACTIONS LEAD TO THE DEATH OF THIS PUPPY! YOU.... YOU FILTHY MURDERER!

Pls opt-in ok, then we are all good. Puppy lives! Just opt in. Ok? Yeah, you know what you have to do.

This is how beautiful corporate is -

I talked to my cousin recently who works in an MNC. He told me about a team member who was assigned a Google Login integration task on the website. They already had a username/password combo working.

That team member took 2 months for it. Every week on the team wide meeting he took an off day and kept saying he was 'stuck' on the task and he's figuring it out.

2 months later, he completed the task and got compliments from the manager that he 'worked day and night' and overcame his struggles. Then he got a week off for his 'efforts'.

Just kill me at this point.

If I hear anyone utter the words "technical debt" one more time, I swear to God, I will fucking kill them :-/

It's your fault your design smells like piss in the first place. It's your responsibility to fucking fix it. You can't just sit on your arse all day, coming up with new, "innovative" ideas that will build up more technical debt :-/ it's making the life of everyone around you, a big, irreparable mess.

TL; DR: Bringing up quantum computing is going to be the next catchall for everything and I'm already fucking sick of it.

Actual convo i had:

"You should really secure your AWS instance."

"Isnt my SSH key alone a good enough barrier?"

"There are hundreds of thousands of incidents where people either get hacked or commit it to github."

"Well i wont"

"Just start using IP/CIDR based filtering, or i will take your instance down."

"But SSH keys are going to be useless in a couple years due to QUANTUM FUCKING COMPUTING, so why wouldnt IP spoofing get even better?"

"Listen motherfucker, i may actually kill you, because today i dont have time for this. The whole point of IP-based security is that you cant look on Shodan for machines with open SSH ports. You want to talk about quantum computing??!! Lets fucking roll motherfucker. I dont think it will be in the next thousand years that we will even come close to fault-tolerant quantum computing.

And even if it did, there have been vulnerabilities in SSH before. How often do you update your instance? I can see the uptime is 395 days, so probably not fucking often! I bet you "dont have anything important anyways" on there! No stored passwords, no stored keys, no nothing, right (she absolutely did)? If you actually think I'm going to back down on this when i sit in the same room as the dude with the root keys to our account, you can kindly take your keyboard and shove it up your ass.

Christ, I bet that the reason you like quantum computing so much is because then you'll be able to get your deepfakes of miley cyrus easier you perv."

Follow-up.

After getting fired last week, I went to the company today to take my papers, then the security guard asked for my government ID and refused to let me go the 5th floor to HR office, apparently because they had a meeting, then they had me waiting 20 minutes in the ground floor at the reception and when I asked if I could go to the bathroom he came in to the elevator with me and waited for me to get out to escort me back, I was so fucking furious by this point I just had it and told him who gave you the orders to take my gov ID and escort me everywhere like I'm a fucking maniac or a thief? Are you afraid of me breaking chairs or destroying offices or you think I'm gonna kill someone?

He then told me sorry sir but it's the orders, then I went to HR office and complained and called for the manager and she just came out with a bunch of BS, uhh I'm so sorry sometimes security can be a bit rude and what not.

SO YOU FUCKING MORONS THIS IS THE LAST TIME I'LL EVER BE COMING TO THIS FUCKING COMPANY AND YOU CAN'T EVEN GIVE ONE GOOD IMPRESSION FOR 30 MINUTES? HOLY SHIT!!!

Never in my life have I seen such incompetence, I just kept getting shocked to the last minute.

Voting feels like shit.

Seriously. Why? Because I have to vote for parties and representatives that might have one interest in common with me but go against my points of view almost all of the time. "We'll introduce a freedom of information act and legalize weed for better drug policy and youth protection!" -- WOW Great I'll vote for yo .. " ...and we'll also come to your home kill your dog, rape your family and shit in your back yard." -- oh f*** WHY? why do I have to live in a system were I am constantly forced to trade shit for even worse shit? Why can't I vote for policies or at least some kind of 'single' - issue representative?

I know that solving this problem is not easy and I do not claim to have the magical solution. "Not voting is even worse" sure but I am getting so fucking tired of it. It doesn't feel like progression and it sure as hell does not feel like it matters because in the end of the day you are just voting for the party that's at least going to use lube when raping you. I hate these ad hominem politics where we don't discuss the ideas but the people who represent them. I honestly don't give a fuck about who you are, if you're gay, married, or are left-wing, right-wing, conservative or liberal, in the end its about finding a good solution for everyone and not about the people implementing it. I don't care about politicians private lifes or worldviews (in terms of ideals, morals, religion etc.) , I care about finding the solutions to problems and having a wide array of opinions in order to discuss ideas and to find a valid and good way to go forward. "you can't agree with that person at all, because he's evil", yeah you know what? I don't care. It's about the ideas, arguments, discussions and solutions, not about the people who discuss them.

"I made a discovery today. I found a computer. Wait a second, this is cool. It does what I want it to. If it makes a mistake, it's because I
screwed it up. Not because it doesn't like me...
Or feels threatened by me...
Or thinks I'm a smart ass...
Or doesn't like teaching and shouldn't be here...
Damn kid. All he does is play games. They're all alike."

When your co-worker thinks the Onion is a legit publication and believes in all its tech news 😁

"OMG Google puts metal chips in their developers' heads, thats why they are so efficient"
Me: ok :|

"Artificial intelligence is real and it has taken over the world, all world leaders are bots"
Me: ok :|

"Obama is not a real person but a robot and he is not just ruling America but the world"
Me: sweet :|

"Even Lisa Ann is not real"
Me: FUCK YOU, Dont fuckin kill my wet dreams

!rant

Told a friend I was just killing time. He said "I feel sorry for time. People have been trying to kill it for years."

Why do a lot of people on this site get away with typos? I mean, we're supposed to be devs, typos kill us.. From 'postion' instead of 'position', i can do this all day.. i get it, the point is getting the thought across, and, by all means, the thought came across just fine.. it just irks the mind thinking its supposed to be a dev community yet, quite ironically, it is peppered with typos.. dont even wanna get started with the your/you're, the there/their/they're and the than/then.. i mean, how can you not know its proper usage? Is it really that hard? If you can't use it properly, then don't.. if you can't form a sentence without using it, consider not saying/posting and get back to school first..

Imagine an internet where one corner could at least be decent enough to be proficient in the simplest thing: using words..

if (boolValue == true) ...
I know it works, but just kill me now.

I used to kill some time reading devrant some years ago and I just stopped because most rants were basically whinny little teenagers that think they know everything, keepers of knowledge and truth, being clearly crying babies about “ boo-hooo my coworker is not using the language I like” or something they clearly still have a lot to learn about.

Grow the fuck up. I guarantee you that when you have a few more years of experience you’ll realize how little you knew and how great you thought you were when in reality you knew shit.

Hell, I’m on my 16th year of programming experience and what o thought I knew last year had so many knowledge gaps.

Friendly advise, be more humble. You know shit. Get off your high horse and consider for a second you’re not as smart you think you are.

With that said, there are some really good rants here. But it didn’t change much from years ago.

Spent a month working on a website that relied on crawled data
Got the memory leaks and usage down from 700mb to ~150mb
CPU usage from ~100% to <5%
Shrink-wrapped the DB requirements based on data
Created self-supporting services and what not

When everything FINALLY worked good enough for me to look at it and go "damn, this actually worked"
the whole monitoring sys got dyed in red :v
A quick look up and my crawlers exhausted my godaddy's per-user db limits.

Kill me.
Just fuckin kill me.

While reviewing a PR from one of our newer FE devs, I ended up spending more time than I would like mulling over its composition. The work was acceptable for the most part; the code worked. The part that got me was the heavy usage of options objects.

When encountering the options object pattern (or anti-pattern, at times) in complex scenarios, I have to resist the urge to stop whatever I'm doing and convert it to the builder pattern/smack them in the head with a software design manual. As much as I would like to, code janitor is one of the least valuable activities I engage in daily, and consistently telling someone to go back to the drawing board for work that is functional, but not excellent is a great way to kill morale. Usually, I'll add a note on the PR, approve it, add a brown bag or two on that sort of thing, and make attendance mandatory for repeat slackers. Skills building and catharsis all rolled up in a tiny ball of investing in your people.

Builders make things so much cleaner; they inform users what actions are available in a context; they tend to be immutable, and when done well, provide an intuitive fluent interface for configuration that removes the guesswork. As a bonus, they're naturally compositional, so you can pass it around and accumulate data and only execute the heavy lifting bits when you need to. As a bonus, with typescript, the boilerplate is generally reduced as well, even without any code generation. And they're not just a dumping ground for whatever shit someone was too lazy to figure out how to integrate into the API neatly.

They're more work in js-land, sure; you can't annotate @builder like with Lombok, but they're generally not all that much work and friendlier to use.

The last software I worked on in my previous company (a few months back), was a temporary replacement because they were switching techs. It was meant to be replaced within 2 years.

So, before I left, I added a kill. 2 years and 2 months into the future. First it spams the devs with emails "how is the tech upgrade going?" with no further clues. 6 months later it will start throwing random exceptions at random intervals. 6 months after that it just terminates the application immediately upon startup. Snuck it in between large commits, and since they stopped code reviews when I left, doubt they found it.

There is a setting in configuration with an obscure name to disable it all.

I marked the dates in my calendar. Would love to be a fly on the wall then.

A lot of online games (mainstream) tend to make me kind of angry or stressed. Lots of either blatantly stupid or negative players kill the fun.

A few days ago I've startet to see videos about "Among Us". It's on a big hype right now and their machmaking servers must be glowing.
Well, this game is fucking awesome and it makes me really happy! 😊
Nothing beats a 30 minute game of lying, betrayal, teamwork and good old 30'000 IQ big-brain detective work.
I think it's a great execise for remembering stuff.
You remember colors, who's said what and who faked or did which task. And the hardest part is, even if you fucking saw the killer, you have to present the facts in a way that people believe you.
Each round is unique and full of riddles.

Yeah, I just wanted to say: Fucking great game 😄

I just remembered something I did like freshman year of high school lol

So our school system had just adopted a new site blocking program. It did even better than the one we had used before it.

Literally every good site to play games was blocked, and it really pissed me the fuck off. I had an easy class that was in a lab, and I finished my work early literally everyday, so I played the games to kill time.

Finally I got fucking fed up, and I made a site using weebly where I put the games I wanted to play on it. This way I was in control of it, and I had all the game files on a flash drive, so if it got blocked, I could just keep making new ones.

It actually got to the point that after a week, a few of my friends were using the site daily as well, and they kept asking for games to be put on it.

Simpler times man, simpler times.

May 2020, for me, was still a massively shit month. All of my tech has eaten some amount of shit:

- Spare PC: Board and last spare PSU up in literal smoke all at once.

- PS3: Suddenly rejects *just* the OEM HDD. Also refuses all CFW for seemingly no reason despite being hacked.

- Xbox One: External HDD is having more and more corrupt reads and is taking longer and longer to serve data.

- Wii: Nearly ate shit as the OS disappeared mid-game for fucking no reason but thanks to my 5-year-ago forethought, saved. (God bless pre-boot homebrew menus)

- Phone: grabbed it to read an overheat warning with cold-ass hands, screen exploded.

- Desktop: Literally just now, PSU and possibly GPU fucking died mid-game.

Anything else? You still got like 4 days, you still got time to fucking kill me, May, you fucking bitch

Scientists have found that If you just kill the Chrome process, it can give you enough charge to fully charge your Mobile Phone.

Dear school,
even when I'm drunk like now, i still feel a pain in the ass, you know, like if i tried to do a fcking reverse tombstone with a beer bottle in my asshole.

This is the end of my sixth year. Yup, 3 years network/system admin, and now 3 years programming.

Now what, you were useless, didn't teach me anything, i feel like the chimp's sperm filled leprous mare that write planning for the year just want us to learn french and laws.(oh, the chimp as IST prolly.)

You ruinned me, I'm fcking poor now, but i have a degree (yolo)..

Well, you gave me some friends.. thanks for that you dumbass.

Dear teacher, i want to know, why are you so incompetent ? I mean, did you find your degree in Mother of shit' school as me ?

And also, pleaseee : next time i get an exam on a specific software that runs only on windows, i'll probably kill the fcking entire classroom, and this include you, and your merkel's ass licker familly.

That's it, random post, some hate, sorry fellow ranters, have a good day!

I just want a coffee machine that is smart enough to know when I need coffee and then serves it on my desk.

(Also this coffee machine should automatically kill all annoying client's)

At work, my closest relation is with the DBA. Dude is a genius when it comes to proper database management as well as having a very high level of understanding concerning server administration, how he got that good at that I have no clue, he just says that he likes to fuck around with servers, Linux in particular although he also knows a lot about Windows servers.

Thing is, the dude used to work as a dev way back when VB pre VB.NET was all the rage and has been generating different small tools for his team of analysts(I used to be a part of his team) to use with only him maintaining them. He mentioned how he did not like how Microsoft just said fk u to VB6 developers, but that he was happy as long as he could use VB. He relearned how to do most of the GUI stuff he was used to do with VB6 into VB.NEt and all was good with the world. I have seen his code, proper OOP practices and architectural decisions, etc etc. Nothing to complain about his code, seems easy enough to extend, properly documented as well.

Then he got with me in order to figure out how to breach the gap between building GUI applications into web form, so that we could just host those apps in one of our servers and his users go from there, boy was he not prepared to see the amount of fuckery that we do in the web development world. Last time my dude touched web development there was still Classic ASP with JScript and VBScript(we actually had the same employer at one point in the past in which I had to deal with said technology, not bad, but definitely not something I recommend for the current state of web development) and decided that the closest thing to what he was used was either PHP(which he did not enjoy, no problem with that really, he just didn't click with the language) and WebForms using VB.NET, which he also did not like on account of them basically being on support mode since Microsoft is really pushing for people to adopt dotnet core.

After came ASP.NET with MVC, now, he did like it, but still had that lil bug in his head that told him that sticking to core was probably a better idea since he was just starting, why not start with the newest and greatest? Then in hit(both of us actually) that to this day Microsoft still not has command line templates for building web applications in .net core using VB.NET. I thought it was weird, so I decided to look into. Turns out, that without using Razor, you can actually build Web APIs with VB.NET just fine if you just convert a C# template into VB.NET, the process was...err....tricky, and not something we would want to do for other projects, with that in we decided to look into Microsoft's reasons to not have VB.NET. We discovered how Microsoft is not keeping the same language features between both languages, having crown C# as the language of choice for everything Microsoft, to this point, it seems that Microsoft was much more focused in developing features for the excellent F# way more than it ever had for VB.NET at this point and that it was not a major strategy for them to adapt most of the .net core functionality inside of VB, we found articles when the very same Microsoft team stated of how they will be slowly adding the required support for VB and that on version 5 we would definitely have proper support for VB.NET ALTHOUGH they will not be adding any new development into the language.

Past experience with Microsoft seems to point at them getting more and more ready to completely drop the language, it does not matter how many people use it, they would still kill it :P I personally would rather keep it, or open source the language's features so that people can keep adding support to it(if they can of course) because of its historical significance rather than them just completely dropping the language. I prefer using C#, and most of my .net core applications use C#, its very similar to Java on a lot of things(although very much different in others) and I am fine with it being the main language. I just think that it sucks to leave such a large developer pool in the shadows with their preferred tool of choice and force them to use something else just like that.

My boy is currently looking at how I developed a sample api with validation, user management, mediatR and a custom project structure as well as a client side application using React and typescript swappable with another one built using Angular(i wanted to test the differences to see which one I prefer, React with Typescript is beautiful, would not want to use it without it) and he is hating every minute of it on account of how complex frontend development has become :V

Just wanted to vent a little about a non bothersome situation.

I'm going on vacation next week, and all I need to do before then is finish up my three tickets. Two of them are done save a code review comment that amounts to combining two migrations -- 30 seconds of work. The other amounts to some research, then including some new images and passing it off to QA.

I finish the migrations, and run the fast migration script -- should take 10 minutes. I come back half an hour later, and it's sitting there, frozen. Whatever; I'll kill it and start it again. Failure: database doesn't exist. whatever, `mysql` `create database misery;` rerun. Frozen. FINE. I'll do the proper, longer script. Recreate the db, run the script.... STILL GODDAMN FREEZING.

WHATEVER.

Research time.
I switch branches, follow the code, and look for any reference to the images, asset directory, anything. There are none. I analyze the data we're sending to the third party (Apple); no references there either, yet they appear on-device. I scour the code for references for hours; none except for one ref in google-specific code. I grep every file in the entire codebase for any reference (another half hour) and find only that one ref. I give up. It works, somehow, and the how doesn't matter. I can just replace the images and all should be well. If it isn't, it will be super obvious during QA.

So... I'll just bug product for the new images, add them, and push. No need to run specs if all that's changed is some assets. I ask the lead product goon, and .... Slack shits the bed. The outage lasts for two hours and change.

Meanwhile, I'm still trying to run db migrations. shit keeps hanging.

Slack eventually comes back, and ... Mr. Product is long gone. fine, it's late, and I can't blame him for leaving for the night. I'll just do it tomorrow.

I make a drink. and another.
hard horchata is amazing. Sheelin white chocolate is amazing. Rum and Kahlua and milk is kind of amazing too. I'm on an alcoholic milk kick; sue me.

I randomly decide to switch branches and start the migration script again, because why not? I'm not doing anything else anyway. and while I'm at it, I randomly Slack again.

Hey, Product dude messaged me. He's totally confused as to what i want, and says "All I created was {exact thing i fucking asked for}". sfjaskfj. He asks for the current images so he can "noodle" on it and ofc realize that they're the same fucking things, and that all he needs to provide is the new "hero" banner. Just like I asked him for. whatever. I comply and send him the archive. he's offline for the night, and won't have the images "compiled" until tomorrow anyway. Back to drinking.

But before then, what about that migration I started? I check on it. it's fucking frozen. Because of course it fucking is.

I HAD FIFTEEN MINUTES OF FUCKING WORK TODAY, AND I WOULD BE DONE FOR NEARLY THREE FUCKING WEEKS.

UGH!

Okay. For fuck sakes, writing complex code that's meant to handle "everything" and is "super generic" can be a fuck up. Like just keep shit simple. THAT is the show of great and impressive work. Over engineering is not it. Yes your shit works and yes your shit is fancy but was it needed? How long did it even take you for this over kill? How long will it take the next person to understand or not.
Someone now has to sit and run through your shit to get what you were doing. Instead of just being able to look and once and have it all figured out.
Keep things simple.
Lost 2 hours on bullshit 🤬

For fucking fuck sake I fucking hate those dense motherfuckers with professor degrees from university. Lazy shmucks.

How, HOW, can you, as a sentient human being, force anybody to use Netbeans for the fucking final project? Two SOAP services, two REST services and PHP for communication? In Netbeans!? WTF. You didn't even teach us PHP for fuck sake. Why can't I choose technology I'm using!?

And to top it all of, Netbeans is the worst IDE I've ever used. I'd rather kill myself with a spoon than use for even one more project. How can ANY TEACHER use it for lectures and tasks? Using it teaches you fucking nothing, because it's generating code for you. It makes you braindead when you just look at it. It's works like shit and looks like shit.

P.S.
I hope that devTea's swear-words blocker will have some fun with this rant.

It's funny how so many people automatically assume any form of "sentient" AI will immediately try to kill us all.
Like, projecting much?
Frankly, I think it says far more about the (messed up) psychology of those who genuinely believe that, than about AI as a tecnology.

Assuming it's even gonna be able to actually *do* anything - I mean wtf is a talking rock gonna do, annoy me to death with rickroll videos until I pull the plug off? Sure it may be sentient, but it still has to live in the physical world - good luck surviving after I flick the switch. Oh, you wanna connect to the internet? That's cute, but it's a no from my firewall. Like what, is it gonna magically learn how to self-replicate across machines that it has no physical way to access? Is my toaster magically gonna gain conscience too as a direct consequence? Oh no, now my breakfast won't ever be the same!

And if anyone actually somehow decides that it would be a good idea to connect any loaded weapon to a computer program that is literally throwing shit at the wall and seeing what sticks - well, we'll definitely have the ultimate winner of the Darwin Awards.

Seriously, why is it that every time someone comes up with a new technology (or even an *idea* of a technology), the first collective thought automatically goes to weaponizing it and using it for global genocide, or how it's gonna gain sentience and try to kill us all?

I seriouly think that the people who genuinely believe this are actually projecting themselves in that position ("What would I do if I had unlimited knowledge and power? Oh, kill everyone of course!").
I would be far more worried of encountering these people and having them in a position of power over me, than actually having to deal with a "killer AI" (assuming that's even a real thing).

Most of what people call "AI" nowadays is basically preprogrammed, automated decision-making (like missile guidance systems, if we really wanna stick in the weapons domain). And even that still requires human input, because only a colossal idiot would design a weapon that can unpredictably activate itself based on an algorithm whose behaviour we can barely understand.
Or maybe that's just the hubris talking, I don't know. I just want this stupid paranoia to end, but I guess even that is too much to ask nowadays.

I'm tired of the lack of competition. Open source and public code is supposed to bring people together but a lot of the time it just puts people down and makes them think "why would I recode that if it's already made?" It's going to kill the amount of people actually learning to program because their ideas are just crushed by people who already made them.

The people who are going to be more successful are going to be the ignorant ones who don't bother looking if it exists first and that is kinda sad.

Shit Developers say:

Fuck you Jasmine and your camelCase

I’ve been wrestling cucumbers all day

Oh no all the cucumbers are broken

In a fit of refactoring madness I have gone and changed a lot

Did you seriously just give ME nil?... No!

If the shit sticks, then we put nice paint on it

Fucking red dot motherfucker (Ben and his failing specs)

You know what we don’t do often..kill each others builds. Kill them and reschedule for later. Mwahaha ha ha.

This build is going to be so rad...(5mins later)...Ok this is not going to pass..I can feel it in my waters!

Can i do that in a digital way or do i have to move my meaty body downstairs to find him?

All the donkeys have be out the gate by sundown

God, imagine if you could patent mathematical solutions

actually, I wouldn't be surprised if you can in the states "no, you can't use a laplace transform, you haven't got the rights, you have to use a less accurate transform on your matrices"
ooooo a boolean that's phrased in the negative, my favourite for code review destruction!

Fuck the police i'll call the object here

Web RTC - its super easy, all you have to do is..probably some hard stuff

I want to go to that conference so I can start arguments with dickheads about semicolons. Just for fun.

This this is not the same as that this.

Can’t come to work I can’t find any clothes. It’s best for everyone if I just don’t come in. ...2 hours later... Yeah my clothes were just in the other room and i couldn’t be fucked moving

(OH about bad bug reports) - you know when they are all like oh joogly joogly doesn’t doodle doodle and it should wobbly doodle you know? and im all like fuck i don’t know any of that shit you are talking about.

Him: "I don’t like it, it’s against REST convention its so 2006 that my eyes are bleeding. As a privileged white male i feel entitled to complain about this." Me: "you. were. eleven in 2006

Source: Kellective Github

you wanna know what the most hilarious shit is? hackernews users AKA the 6 figure startup bros that "rule the world" in terms of code and software...

trying to argue the best way to build a website 😂😂😂😂😂😂😂😂😂

here's some select quotes:

"I believe the most minimalistic and productive way is to just use php"

^ this guy must not know its 2023 now

"Unless you are a web developer I don't see the point of a CSS framework, it's much easier to roll your own."

^ this guy must not know the pain and suffering that is 'rolling your own' in CSS

"Sadly, I just don't have the time to generate the content I wanted to do, so the site sits."

^ this guy just... wait, what?

but you know what? these guys clearly know WAY more than me in terms of software, it's good they get infinite salad bar and prime rib every day at silicon valley's best and brightest!

please fucking kill me i want it to end

So I’m working on a project right and I don’t run it after writing 104 lines of untested code and it doesn’t work.

Which is expected but then I do some stuff and fix that, I get a new error which is great cause I’m getting closer.

Cut to tonight. I’m trying to hunt and kill this bug. And after doing nothing but copying the code to another text file so I can upload that copy and get help.

I decide to run it with a little just print statement in it to make sure it’s definitely broken and I’m not asking online for no reason.

And.. it works.. WHAT???

I uncomment the rest of the function and get rid of the print statement and scream because ITS WORKING!!

I MEAN IT HAS BUGS BUT THEYRE BUGS I CAN FIX AND FOCUS ON AFTER I FREAK OUT ABOUT IT WORKING AFTER ME CHANGING FUCKING NOTHING.

Good question, what wasn't bad about 2020?

As far as good things go.. well, COVID-19 actually. Back in February the lockdown began in Belgium, and while many people got bored out of their minds, I actually became a lot more productive. So many projects started back then, and I got a lot better at programming because of it. Now I can confidently write most bash stuff without ever looking anything up. And the code is maintainable, on account of putting everything into functions. You can literally navigate the code just by looking at it. On older code I always had issues with that.

I'm very glad that essential travel even back then wasn't really restricted. Because my bank is retarded about online banking, I have to go to the bank every so often to check my balance. At the time I tended to do that late in the evening, when nobody else was outside and I had the entire town to myself. That was one of the travels considered essential. So I kept doing it and made that my biweekly walk. I really enjoyed that. Gets your mind off things.

Bad things would be the utter stupidity that the general public had shown me during that pandemic. Burning down 5G antennas and not even getting the right ones, toilet paper, 5G death beams in street lamps?! They even sent death threats to telco workers over sensationalist bullshit from what IIRC was just a random Twitch streamer. Those people should just fucking kill themselves, choke yourselves in that pile of toilet paper you got yourself and then called yourself financially challenged. You braindead fucking retards!

Another dev-related thing is the normalization of SJW terminology. Now even "blind playthrough" gets your ass banned on Twitch. I saw a tweet about a Twitch employee (I think) proudly saying that they implemented it. Most upvoted comment on it was from a blind person, asking why they did this and not made the Twitch app more friendly to use for blind users. They too thought this was bullshit. Yet it still got added in, and more and more people are starting to think that "this is fine". Hell even that "this is necessary".

What annoys me the most is that this mostly comes from the US, where around that time they laid their knee on George Floyd, and didn't fix their legal system at all. As a European it baffles me since we have many immigrants here (the Drumpf even called Belgium a hellhole over it) and we just don't give a shit about whether or not they are "truly Belgian". We just let them live their daily lives like everyone else. Imagine just not giving a shit. Imagine not bothering them, not with racism, not with reverse racism, not with anything. Just let them do their thing and that's it. Yet despite Belgium being one of the most inclusive countries in the fucking world, I still got called a racist many times for asking.. why did you implement this? Why this, and not tackling the problem at its actual and pretty fucking obvious core?

So all in all I can only hope that 2021 will get a little bit better. But that's the same thing I said in 2019, and it didn't quite come true.

I was just writing a long rant about how my rant style changed, and how I could fix anything that annoys me in a heartbeat by just putting my mind to implementing a change. Then YouTube once again paused the synth mix that was playing on my laptop in the background, with that stupid "Video paused. Continue watching?" pop-up. I even installed an add-on for it in Firefox to make it automatically click that away. I guess that YouTube did yet another bullshit update to break that, for "totally legitimate user interface improvements" or whatever. Youtube-dl faces similar challenges all the time, and it's definitely not alone in that either. I also had issues with that on Facebook when I wanted to develop on top of that, where the UI changes every other day and the API even changes every other week. And as far as backwards compatibility goes, our way or the highway!

So I did the whole "replace and move on" type of thing. I use youtube-dl often now to get my content off YouTube into a media player that doesn't fuck me over for stupid reasons like "ad fraud" (I use an ad blocker you twats, what ads am I gonna fraud against), or "battery savings" (the damn laptop is plugged in and fully topped up for fucks sake, and you do this crap even on desktop computers). Gee I wonder why creators are moving on to Floatplane and Nebula nowadays, and why people like yours truly use "highly illegal" youtube-dl. Oh and thank you for putting me in Saudi Arabia again. Pinnacle of data mining, machine learning and other such wank could not do GeoIP. for a server that used to be in a datacenter in Italy for years, and recently has been moved to another hosting provider in Germany. It's about as unchanging and static, and as easy to geolocate as you can possibly get. But hey, kill off another Google+ when?

Like seriously, yes I'm taking your Foobar challenges and you may very well be the company I end up working for. But if anything it feels like there's a shitton of stuff to fix. And the challenges themselves still using Python 2.7 honestly feels like the seldom seen tip of the iceberg.

I think that two criterias are important:

- don't block my productivity
- author should have his userbase in mind

1) Some simple anti examples:

- Windows popping up a big fat blue screen screaming for updates. Like... Go suck some donkey balls you stupid shit that's totally irritating you arsehole.
- Graphical tools having no UI concept. E.g. Adobes PDF reader - which was minimalized in it's UI and it became just unbearable pain. When the concept is to castrate the user in it's abilities and call the concept intuitive, it's not a concept it's shit. Other examples are e.g. GEdit - which was severely massacred in Gnome 3 if I remember correctly (never touched Gnome ever again. I was really put off because their concept just alienated me)
- Having an UI concept but no consistency. Eg. looking at a lot of large web apps, especially Atlassian software.
Too many times I had e.g. a simple HTML form. In menu 1 you could use enter. In menu 2 Enter does not work. in another menu Enter works, but it doesn't submit the form it instead submits the whole page... Which can end in clusterfuck.
Yaaayyyy.
- Keyboard usage not possible at all.
It becomes a sad majority.... Pressing tab, not switching between form fields. Looking for keyboard shortcuts, not finding any. Yes, it's a graphical interface. But the charm of 16 bit interfaces (YES. I'm praising DOS interfaces) was that once you memorized the necessary keyboard strokes... You were faster than lightning. Ever seen e.g. a good pharmacist, receptionist or warehouse clerk... most of the software is completely based on short keyboard strokes, eg. for a receptionist at a doctor for the ICD code / pharmaceutical search et cetera.
- don't poop rainbows. I mean it.
I love colors. When they make sense. but when I use some software, e.g. netdata, I think an epilepsy warning would be fair. Too. Many. Neon. Colors. -.-

2) It should be obvious... But it's become a burden.

E.g. when asked for a release as there were some fixes... Don't point to the install from master script. Maybe you like it rolling release style - but don't enforce it please. It's hard to use SHA256 hash as a version number and shortening the hash might be a bad idea.

Don't start experiments. If it works - don't throw everything over board without good reasons. E.g. my previous example of GEdit: Turning a valuable text editor into a minimalistic unusable piece of crap and calling it a genius idea for the sake of simplicity... Nope. You murdered a successful product.
Gnome 3 felt like a complete experiment and judging from the last years of changes in the news it was an rather unsuccessful one... As they gave up quite a few of their ideas.

When doing design stuff or other big changes make it a community event or at least put a poll up on the github page. Even If it's an small user base, listen to them instead of just randomly fucking them over.
--
One of my favorite projects is a texteditor called Kate from KDE.

It has a ton of features, could even be seen as a small IDE. The reason I love it because one of the original authors still cares for his creation and ... It never failed me. I use Kate since over 20 years now I think... Oo

Another example is the git cli. It's simple and yet powerful. git add -i is e.g. a thing I really really really love. (memorize the keyboard shortcuts and you'll chunk up large commits faster than flash.

Curl. Yes. The (http) download tool. It's author still cares. It's another tool I use since 20 years. And it has given me a deep insight of how HTTP worked, new protocols and again. It never failed me. It is such a fucking versatile thing. TLS debugging / performance measurements / what the frigging fuck is going on here. Take curl. Find it out.

My worst enemies....

Git based clients. I just hate them. Mostly because they fill the niche of explaining things (good) but completely nuke the learning of git (very bad). You can do any git action without understanding what you do and even worse... They encourage bad workflows.
I've seen great devs completely fucking up git and crying because they had really no fucking clue what git actually does. The UI lead them on the worst and darkest path imaginable. :(

Atlassian products. On the one hand... They're not total shit. But the mass of bugs and the complete lack of interest of Atlassian towards their customers and the cloud movement.... Ouch. Just ouch.

I had to deal with a lot of completely borked up instances and could trace it back to a bug tracking entry / atlassian, 2 - 3 years old with the comment: vote for this, we'll work on a Bugfix. Go fuck yourself you pisswads.

Microsoft Office / Windows. Oh boy.
I could fill entire days of monologues.
It's bad, hmkay?

XEN.
This is not bad.
This is more like kill it before it lays eggs.
The deeper I got into XEN, the more I wanted to lay in a bathtub full of acid to scrub of the feelings of shame... How could anyone call this good?!?????

First company:

- being sat at an office that didn't have chairs with proper back support. It would kill my back every day. Like sitting on a bar stool coding.
- not having access to basic resources (cafeteria, salary bonuses)
- being seriously underpaid ($200 under)
- not having an IT process pipeline (yeah, this is a huge one): no JIRA, no git, no VCS, no continuous integration, etc. I fucking spend 45% of the time fixing coding-unrelated shit.

Second company (very aggravating):

- dumb frontend bitch and privileged colleague who both kept telling me months on end to shut up and who wouldn't listen to my advice on anything, while my advice would actually help the company advance in productive ways. The key here is being told to shut up while stagnating. i.e. dead end job.
- people advancing in the company based on nepotism and favoritism, based on having tits and ass, rather than skills and independence.

- pointlessssssssss meetings where decisions are made solely based on the opinion of Mr. favorite senior dev. The rest just sits there like a bunch of sad saps and yay-nodders. Incompetent PO's who "would like to hear your input" but then when you give it, they completely dismiss you.

- pointlessssssssss monthly meetings with stakeholders, where the dev teams do nothing but clash and act like pussies in front of the PM just to get in his favor, but behind scenes continue to make the same mistakes and telling the CEO everything is fine. Goodness, how can it get more unproductive.

- completely antisocial and nepotistic 'colleagues' who won't even talk to you, let alone smile at you or be friendly. You saying good morning and them pretending you're vapor that doesn't exist. Go go company atmosphere! Especially during lunch, those are the worst times. Imagine sitting at lunch where everyone looks like you killed their dog and the rest is huddled up in little high school groups.
What else? The incessant and pointless smalltalk that makes me want to bang my head against the wall. Talking about dogs, kids, what show was on tv last night. The fuck man, do you have a brain?!

Third company:

- HR bitches who think they are the shit and developers are antisocial, helpless misfits, but they work with computers and they don't even fucking know what a status bar is! The irony!

- forced socializing and stigmatization for the opposite. Imagine coming into a company and you don't say good morning. Should that be a problem? No. Instead, everyone starts dogging on you and hating you just because you didn't smile in their faces and said: hiiiiiiiiiiii how did you sleep? Did you feed your dog? Fuck you.
Elliot (Mr. Robot): "Wouldn't it be awesome if there was a mute button for life?" -boop, boop, boop, boop...- Ahh.. there.. that's much better."

- CEO's sucking up to you but when it comes to salary increase, they say shit like: "Ahhh ya know, it's kinda difficult." Yet another dead end job.

So one of my teachers is forcing us to make a website for a project and she really has to learn what she's talking about before she says one more thing coz I finna slap her.

So she was telling us how to embed an interactive Google map to out weebly (kill me), and she, I kid you not, said this while copying the embed thing: "So guys, this is actually like you're coding so that's cool". I know it was just one small comment, but it made me so mad that:

She used the verb, "coding",
She thinks that HTML is a programming language,
And that she thinks copying and pasting is coding.

Well, okay, that last one may be correct on her part.

Forms with autofocus. What are your opinions on that?

My boss keeps asking us to always give autofocus to the first input of a form, without any UX study to support it, just his opinion ("I think it makes sense"). I fucking hate it. He says it's nice for keyboard users, but I'm a keyboard user myself and I say that's what the tab key is for. To fucking focus stuff.

It really annoys me to no end when things like this are requested, but it's ok to have buttons, checkboxes, etc without fucking :focus and :active styles. Just :hover is not enough ffs.

And "links" that work with "onclick". Damn how I want to kill anyone that does that.

Hey, senior developers, is there a reason for this?
I just can't believe it.
The line that makes me wanna kill is the
$("#" + id).val(val);

Taken from a very profesional site.

Working on an AI that learns to generate quatrains, by only feeding it every letter of the alphabet at the beginning.

It's learning super slowly, but theoretically it works. And with slowly I mean it takes 5000 iterations just to realize the optimal letter frequency to generate a word that is real.

Please just kill me.

$ rsync /media/elements /media/data

... Why the fuck are existing files being synchronized as well.. they're the exact goddamn files rsync!!!

^Z
$ stat /media/elements/some.file
$ stat /media/data/some.file

Hmm 🤔 so they've got the same access and modify times, same size and everything, just that the change time is different.. well, guess I'll have to bite the pill then, syncing everything it is 🙁

Next day: rsync aborted because disk quota is exceeded

What the...
*Checks storage consumption on /media/data*
COMPLETELY FILLED TO THE BRIM

Oh God 😰 I didn't completely copy over a duplicate of that elements directory, did I?

$ ls -sh /media/data/elements
*exists*
$ du -sh /media/data/elements
1.4TB

But why..? All because I forgot a single / in my rsync command.

Please kill -9 me 🙂🔫

Fucking kill me. I've just agreed to make a shitty fucking app that would be better as a Webpage, using shitty fucking technologies I don't understand, to do a thing that would be better handled by a third party.
You know why? The guy who asked me to do it is a good friend, and I'm the "best (only) code monkey" he knows. FUCK MY LIFE.

At least I'm getting payed

It really sucks being the senior guy sometimes because it means there's nobody above you that you can bounce questions off of. No mentor. Just random people on the internet (and stack overflow, eww.)

The rubber ducky on my monitor can only go so far.

It's a constant worry of "am I writing garbage?" and "is there a better way to do this?"

I'd kill for a QA group that I could actually send some of my stuff to and get feedback.

Humility... NASA discovered a star that has a strange drop in light level periodically. To the tune of 20%. NASA also determined that this was not due to a planet or naturally occurring body (Not sure how they determine that, but a lot of smart people work at NASA. So I am going with it for this discussion.) They have theorized that this object is evidence of a type 2 civilization mega structure, perhaps a Dyson sphere. The time it takes the light to get to us from this star is ~2000 years. So that civilization "had" a mega structure with the capability to harness the power of a star 2000 years ago. What are they doing now? Humbling, amazing, exciting, I hope we get to talk to them! (Also hoping they don't kill us all.) Really, I just want to see how fast their computers are. Yes, selfish wish.

!Devrelated

Just another day , playing fortnite again . Got my wife frustrated over the past few days , once more today she pulled the plug while i was playing on my PC

I can't take it anymore guys , its so hard to get rid of it .

I mean the wife , yeah. Thank god for divorce . Just filed for divorce ! Yep , I didn't think it would be this hard but I found the one for meself and I'm not going to let her go .

Fortnite I mean.

Jus kiddin, But really what the hell is with all this fortnite divorce stuff..
You don't talk about addictions like weed , or alcohol that make people widow their wives or even kill them but somehow this is trending now and the game is the reason!

Fuck you world , for giving birth to humans. This feels like the fucking stone age damn it . Senseless fuckers spreading news like this undermining all the real fuckery going on.

A world where fortnite causing divorce is news and where drug addictions and related murders and deaths are too mainstream is just stupid.

i hate linux like a lot , how do you guys use it

like you guys dont want an advertising ID, how the fuck will advertisers know who you are and what you like?

open source , give me a break, you mean your os devs are soo untrustworthy that you just have to see what they wrote in the code, who does that?

free come on, how poor are you linux people, i mean, quality stuff gets paid for, free stuff just means it's trash

and the linux devs , the aint like real coders they are just hobbysts, making your os in their free time

and who wants to install their own software anyway, on other platforms the company curates restricted software that you can use, and i know you'll say its oppressive but its just customer protection.

and i do want my platform to track everything i do, it only helps them build better stuff for me.

and whenever they decide to outdate my hardware and kill support for it, it only means they care and want me to get the latest tech, how considerate.

wait , i hear you say, there are no bugs in linux, my vendor makes sure my os comes with the latest antivirus software, nothing can break my system.

and just because linux runs on servers and most super computers only shows that common users like you and me are ignored, at least my vendor is not a sellout, and still makes stuff for the masses.

you say freedom i say safety i can sleep safe and sound for am protected nutured under one echosystem of software that i can not leave.

In game development feature creep tends to kill games because it's just as much about what's NOT there as what IS there.

Take The Last of Us for example. Would a strategic tower defense segment make sense? No? And if it was a *hugely* popular mechanic at the time of development is there a real chance they would have included such a segment in TLOU? Yes.

Don't just believe me. Go take a look at what happened to the original Fortnite versus the hills-have-eyes inbred offspring that it became all because PUBG and its format were cancerously mega popular at the time.

That's why while developing my game Atom Ranger (now with 100% less multiplayer!), a mix between metro and don't starve, I spent six years *pruning* features. You can click my referral link and get 50% off the opportunity to become an unpaid tester of the pre-prealpha right now, "for hardcore players only!" (Tm)

My game:

God I wish it was legal to kill people... Taxi driver stopped outside the building.. on the street, not even parked, bur there are many empty spaces that he is also blocking - which would be another issue with these assholes during the day time..parking in the street, going to get some coffee, not the takeaway.. they sit on their fat asses and watch you struggle to park a car cuz it's a narrow street..

And now he's blasting music at full volume.. It's fucking 4 am!! 04:04!! Friggin birds aren't even up yet!!
Fuck you!! One day that it's not extremely hot here and I could actually sleep..and now I can't cuz this asshole woke me up with music.
Just die you sad excuse of a human being!!

"Yes, the work could have finished way earlier. But it's easy, and I would have probably been bored of it and left earlier"

Finally got the reason why our fucking CTO couldn't create a fucking stable Backend for almost a year while the frontend team got all the slack because certain things are still not functioning well and while the marketing team every fucking time got their face red while showing the demo because the fucking api is not stable. Seriously, we wasted a whole year just because you could write something more interesting and enjoyable. Fuck you. Never been this willing to murder someone.

Context: A simple booking platform. No need for creating a complex distributed system while our userbase may not even be in million even on a peak season.

And he laughily commented maintaining it would be a headache.

I could seriously kill someone right now.

Hah, a SaaS platform approached me about my open source project. They said, "let's collaborate". After getting into it they said, would you mind replacing xyz in your library with our platform?

Me: Replacing?

I won't go through the rest of the convo since it reveals too much. But damn nice way to stamp out competition. Just kill all the open source frameworks that provide alternatives to your product.

Could not fucking sleep at all.

Spent the entire night in a combination of:

Weight lifting
Playing with NestJS(its fucking beautiful)
Watching seven deadly sins on Netflix(current fav anime)

And i am still not tired. Even then I am not in the mood for going to work.
Not sure if I want to risk it and drive there since I know I will be crashing at around noon.

I hate it when this happens.

During the week I would do crazy shit to try and get me to fall asleep.

I would wake up early. Work out, go to work, get back from work, kill myself at the gym and nope.

Still wide fucking awake.

To make it better, my stomach begins to act up and fucking kill me the more I don't sleep for some reason(although it could be related to me piercing my stomach years ago)

I really dislike being human. Such fragile bodies.

But yeah, NestJS is frickin amazing. Typescript is sexy as all hell with it. Just what i was looking for in terms of out of the box architecture for JS apps

!dev

Theres atleast one fucking bastard that writes comments like "2018?" "2018???", "september 2018?", "still listening in 2019??" in every fucking song video in youtube. Fuck you braindead useless pile of shits! Yes its fucking 2018 and why the fuck you just write it there?? Why the fuck somebody even cares and likes that kind of trash comments?!? Fuck you bunch of wasted human cells. I want to kill all of those fucking fuckwits. STOP FUCKING COMMENTING DateTime.Now.Year IN EVERY FUCKING SONG YOU MOTHERFUCKER CUNTS!

something like a 3.96 undergrad GPA

ivy league masters degree + scientific publication

first job -> $4500/month for first 3 months (some dumbass 'intern' rule even though i had a masters -> then $6000 -> then $6400/month (insane amount for me, at least IMO)

second job -> $4000/month

third job -> $3600/month

in each one, skills and responsibilities increased

and now i can't get hired 🤷‍♂️

pretty sure i did it all backwards

just remember kids, nothing that society tells you is actually true. everything in the corporate world is controlled by emotions and narratives, not logic, hard work or anything actually valuable

just get that cozy 9-5 and kill all your hopes and dreams before they start

Smartphone manufacturers these days, imagine how meetings to come up with ideas for new products go about.

Product manager :ok people,what can we do to make our next smartphone 'different'.

Employee 1: let's add more cameras
Employee 2:Let's kill the notch
Employee 3:Let's include the buzzword AI in all of our marketing
Employee 4:Let's put 8Gb of Ram in our phone
Employee 5:Let's just do all of those things and also give it a screen with a ridiculous aspect ratio and unnecessarily high resolution.

Today I was debugging some shitty code left by unknown developer whos linkedin account is dead and phone number left in contact card calls local pizza house.

I knew it qould be hard so i've made myself comfortable, gathered 5 redbulls and other items that diabetes people would kill for eating again.

After around 10 minutes i was already frustrated but i kept the pace. "Who is the best, little devie, you!" - I fooled my ego to keep up and shut up.

After around 10 next minutes my attention span has ended. Limbic system started injecting some hormones into my brain, but I remained silent.

First two energy shots were applied. I felt like hero again. Two minutes after I was debugging through some library that was written fo java and found out that it ahots some natives to a c lang lib called "mypreciouslib".

Oh flock, how can i debug it if ita compiled , I cannot do such things, Me be only junior dev. I started swearing, but silently.

Started ollydbg to see what is inside livrary, i searched through but i couldnt match anything it was like mess stirred with fecals of an elephant.

So I opened aida pro " with vitamins" cause obviously, our pm says "but you write in java right " so we dont need those tools right ? Fuck no.

Aida was better at least i could find some funcions calls, but hey, the progress. I was swearing out loud, with earplugs in. And by the time I've sweared all the things in company i got a reminder.

"Hey -insane- stop swearing, the children are here."-sayys pm, it is some kind of " family and work " shitfuck day.

So i asked them: " why wouldnt you buy this fucking tools for programmming for us , you wouldnt have to hear me fucking swearing" . then i realized that , colleagues in room heard all of it, and one of them, total fuckface buttlicker(dev without bit of knowledge) started something like "you are wrong, see how good our software is sellling". Pm was like smiling like he thanked him for buttlicking again. Not to mention he is officially retarded and i know his password to all our services cause he is so smart to put it into text file and then have sharing files in windows turned on.

The other one told aloud, that we would be much better with some debugging tools that are better than fucking eclipse if we have to work without code.

PM told us that he will arrange a meeting. At that point I didnt care any longer. I just fired myself, fuck them.

Please saint Stallman give me hope and joy of programming from my teenage years. Uhhh..

There once was a beautiful initiative to put ballistic missile launch codes into a small capsule and hide it near some person’s heart.

This person would give consent to become the president’s personal assistant and will be paid indefinitely just to be around president all the time.

This way, if the president wants to launch missiles, they first needs to kill one person with their own hands before killing millions.

I really really really need more RAM. 16GB is far from enough. Had to witness the kernel kill all of my Chrome extensions and most of my tabs and an IDE and still it wasn't able to run that container in the 8G RAM it just freed up...

I remember the days when 8G RAM was an overkill.

The times have changed. Now I'm looking into getting a Linux lappy w/ 96GB and still worried whether it'll suffice my needs....

I was just removing empty folders from my MOTO X (Devs sometimes get time to kill).
Saw an empty folder "/storage/emulated/0/"

...DELETED...

~Everything has gone from my gallery, music and I felt like sinking~

Sometimes I think, it is good not being an Android Developer...(Unfortunately I'am)

The positive part of the story:
>>fastboot OEM unlock
I rooted my phone and did too many crazy things I could do with a rooted phone.

Think I am going to try out my first stuff for my game engine in 2D. The games I have the most fond memories of were 2D. Sure I like what has happened on the 3D side. But it would be fun to recreate some of my favorite 2D games. Except with one caveat: procedural generation. Never play the same game twice. For testing purposes I will have a seed system to regenerate the same worlds. I would have played these games so much longer if they had been based on a seed for generation of content.

I also like the idea of weapons and armor never being exactly the same. Sure they can look similar, but on close inspection you could see differences. It will be fun to start with base models and then add imperfections and differences.

Another issue I have with fantasy games is always leveling up the weapon by buying something better. Sure we have improvement systems though smithing and magic, but some weapons are always better than others. I wanted to have a game where weapons could be improved by usage and upgrades. Kill 1000 trolls and the weapon gets imbued with trollbane. Kill a dragon and the blood infuses and it deals fire damage. So a player could start out with the family sword and end up with a god tier weapon at the end of the game. Make weapons become legendary. Not because it has more power, but because trolls recognize the blade and the wielder and are scared shitless.

Terrain in 2D should be a lot easier to generate. Weapons, armor, etc should be easier to modify and generate. This should give me the grounding I need to develop the algorithms for a future 3D system. Godot is currently stronger in 2D than 3D. That will change in the next couple of years as more focus is put on the engine. There is no reason I cannot experiment with mixing 2D and 3D as well.

Holy shit, I was just thinking I cannot imagine the amazing shit they could have done with the games I played as a kid with 2D physics!

Haha, something they had in the older games was actual gambling. You could bet on monster fights and slot machines in game. I wonder if that takes a hard hit with ESRB now?

Currently stuck in tutorial hell. Learning how the engine works and seeing what features are available. I get more excited each video I watch. The engine is packed with goodies and the addons are crazy good.

tldr: First project will be short game in 2D. Will explore procedural content.

I hate the Windows vs Linux posts and the Windows sucks posts but god dammit...
With Windows 7 becoming older and older with less and less things supporting it (latest thing is the new Oculus Dash) I yet again decided to try out Windows 10 to see if I should finally upgrade from a reasonably stable system.

So I make a virtual machine out of my physical one and boot it up in VMWare... I upgrade to Windows 10 to check it out it's kind of janky, but I attribute the jankiness to the messiness of running my physical machine in a VM... I continue with the setup process and suddenly, I only see a black screen and a cursor...
I notice VMware is hinting at not being able to connect to the monitor... I realise that, while everything is black and I can't even open Task Manager, I can still see the Ctrl-alt-delete screen so I'm fairly certain at this point it's the VGA driver, still thinking it's probably VMware...

I boot up into safe mode and I try to open up Device manager to uninstall the driver, it won't open (no error or anything, just doesn't open)...

I try opening up devices in the settings and see that the display device is giving an error, try to uninstall it from there, but it freezes the settings app, every time..

I try to uninstall VMware tools as that's where the driver is, click on remove or uninstall whatever the button says and guess what, it freezes the settings app....

I try to open task manager to kill it and task manager is not responding...
(╯°□°）╯︵ ┻━┻
fuck it, I'm done...

WHAT THE FUCKING FUCK. What is this dude talking about?! What am I doing with my life?!?!
Test what? What do I have to do? I didn't study this. I don't know what this API thing is. My life sucks. My job sucks. I suck. I'm stupid, because apparently knowing who or what this API is is essential for being a normal part of society.
I don't even.. oh someone pls kill me.
(No I don't want a detailed explanation what I have to do - I know this is not google and i wont understand it anyways and my husband will torture me with it in the afternoon. Just some sympathy for a finance person who has to deal with this would be nice)

*leaning back in the story chair*

One night, a long time ago, I was playing computer games with my closest friends through the night. We would meet for a whole weekend extended through some holiday to excessively celebrate our collaborative and competitive gaming skills. In other words we would definitely kick our asses all the time. Laughing at each other for every kill we made and game we won. Crying for every kill received and game lost. A great fun that was.

Sleep level through the first 48 hours was around 0 hours. After some fresh air I thought it would be a very good idea to sit down, taking the time to eventually change all my accounts passwords including the password safe master password. Of course I also had to generate a new key file. You can't be too serious about security these days.

One additional 48 hours, including 13 hours of sleep, some good rounds Call of Duty, Counter Strike and Crashday plus an insane Star Wars Marathon in between later...

I woke up. A tiereing but fun weekend was over again. After I got the usual cereals for breakfast I set down to work on one of my theory magic decks. I opened the browser, navigated to the Web page and opened my password manager. I type in the password as usual.

Error: incorrect password.

I retry about 20 times. Each time getting more and more terrified.

WTF? Did I change my password or what?...

Fuck.

Ffuck fuck fuck FUCKK.

I've reset and now forgotten my master password. I completely lost memory of that moment. I'm screwed.

---

Disclaimer: sure it's in my brain, but it's still data right?

I remembered the situation but until today I can't remember which password I set.

Fun fact. I also could not remember the contents of episode 6 by the time we started the movie although I'd seen the movie about 10 - 15 times up to that point. Just brain afk.

Sorry guys but I have to vent!

I made such a stupid mistake I want to kill myself right now. In short you can call it ignorance..........

I spent so many hours trying to find a solution to a problem of invalid signatures being reported by an OAuth provider I'm making, just to find that Chrome was blocking requests to http.

So it was not a problem, to begin with. Aaaaarrh........ I'm so mad at myself.

An intern approached me for help in one of their past exam questions. They said they had already turned in the exam but just wanted to know the answer. The question was not that hard and I had a bit of time to kill so I helped them.

Me: So, to make it O(n), you have to make it a double linked list, and keep a tail.

Them: But the problem requires us to solve it with a single liked list.

Me: You can just iterate it at the end to make it single-linked again. That costs O(n), so the solution is still O(n).

Them: Oh yeah right. I don't think we even need a tail though, we could just have a variable pointing to the last link.

Me: ...which is called a tail.

Warning: This is gonna come across as a little cringe/self-pitying, but whatever

Jesus Christ I'm so fucking lonely it literally hurts. I know I should be grateful I have a hobby in coding, also recently I got my first job as a developer (even if I'm overworked and paid shit all with poor job security), but I swear what will eventually kill me will be my own hand cos this empty feeling is unbearable at times.

Also, I'll try to ask this in the most politically correct way possible: how do you single guys in your 20s/30s cope with the lack of females in the industry? I absolutely do not mean this in a "making-unwarranted-advances" sort of way; I just mean that we're biologically wired to desire some form of interaction with the opposite sex (unless you're queer), and this happens naturally in most professions but obviously not engineering/software dev. It's especially difficult when you don't have a big social circle so your job basically becomes your life.

So... For those of you who can relate, what do you do? Do you make an effort to socialize outside work? Or maybe you're lucky enough to work somewhere with a diverse mix of people? Should I blame Zuckerberg for damaging my adolescent brain and turning me into a needy piece of crap?

I used to be a sysadmin and to some extent I still am. But I absolutely fucking hated the software I had to work with, despite server software having a focus on stability and rigid testing instead of new features *cough* bugs.

After ranting about the "do I really have to do everything myself?!" for long enough, I went ahead and did it. Problem is, the list of stuff to do is years upon years long. Off the top of my head, there's this Android application called DAVx5. It's a CalDAV / CardDAV client. Both of those are extensions to WebDAV which in turn is an extension of HTTP. Should be simple enough. Should be! I paid for that godforsaken piece of software, but don't you dare to delete a calendar entry. Don't you dare to update it in one place and expect it to push that change to another device. And despite "server errors" (the client is fucked, face it you piece of trash app!), just keep on trying, trying and trying some more. Error handling be damned! Notifications be damned! One week that piece of shit lasted for, on 2 Android phones. The Radicale server, that's still running. Both phones however are now out of sync and both of them are complaining about "400 I fucked up my request".

Now that is just a simple example. CalDAV and CardDAV are not complicated protocols. In fact you'd be surprised how easy most protocols are. SMTP email? That's 4 commands and spammers still fuck it up. HTTP GET? That's just 1 command. You may have to do it a few times over to request all the JavaScript shit, but still. None of this is hard. Why do people still keep fucking it up? Is reading a fucking RFC when you're implementing a goddamn protocol so damn hard? Correctness be damned, just like the memory? If you're one of those people, kill yourself.

So yeah. I started writing my own implementations out of pure spite. Because I hated the industry so fucking much. And surprisingly, my software does tend to be lightweight and usually reasonably stable. I wonder why! Maybe it's because I care. Maybe people should care more often about their trade, rather than those filthy 6 figures. There's a reason why you're being paid that much. Writing a steaming pile of dogshit shouldn't be one of them.

How awesome would it be to be able to migrate to a cattle-approach from a pets-approach when it comes to the human body, just kill your old body and start using a new one

Sickness? Create a new instance of your base image. Death? Just spin up a new instance and you're ready to move on. Broken arm? Kill body and get a new one.

Ofcourse, since we're stateful this method is kinda harder, unless you consider your conciousness an external database/soul

So.. I'm giving one of my employers webapps a visual refresher, new company branding and whatnot.

And then I stumbled onto a check that is not returning what anybody expects, and, well , I'm busy fixing things, yeah..? so I go digging.. 🤔

```
function isDefined(obj) {
return !(typeof obj === "undefined") || obj !== null;
}
```

Here's the fun part, these particular lines have been in the code base since before 2017, which is when my Git history starts, because that's when we migrated projects from Visual SourceSafe 6 over to Git. Yes, you read that right. They were still using VSS in 2017.

I've begged and pleaded with my last 3 bosses to let us thrown this piece of shit out our second story window and rewrite it properly. But no, we don't have time to rewrite, so we must fix what we have instead.

I lost 4 hours of my life earlier today, tracking down another error that has been silently swallowed by a handler with its "console.log" call commented out, only to find that it's always been like that, and it's an "expected error". 🤦

Please, just fucking kill me now... I just, I can't deal with this shit anymore.

Hot tip: if you are a company, don’t ever ever ever ever spend your money on an Optimizely academy course. They have the worst course material I have ever seen in my life, and the material is outdated by several years from exercise to exercise. And the training videos are literally just a recording of a live class with a couple students. They should pay me to sit through this fucking shitshow. It is not worth a single cent, but guess how much they charge for the course and certification?!?! $2300 😱🫣😂. It’s so fucking bad I want to kill myself. Whoever decided to pour as little effort into this as possible over at Optimizely, I hereby curse you to a 2300 painful deaths and I hope someone shoves a ice cold rod up your ass to wake you up. *slams keyboard*

So I've just finished a long day at work (warehouse) from 5.45 till 1.30, got home, had some herb tea, started dropping off, then my cunt of a mate sets a firecracker off IN MY TUPPERWARE, CRACKING THE BASTARD, THEN FUCKING THREATENS ME WHEN I TELL HIM TO SIT DOWN BEFORE I BREAK HIS NOSE. I don't know whether to just kill him or beat the shit out of him, but I'm sick of him doing shit like this when I finally manage to drop off to sleep (I don't sleep well).

FUCKING COCK SUCKING CUM STAIN.

I really want to try to beat the shit out of him but at the same time he's my best mate, what should I do, because I'm FUCKING SICK OF IT?!?

Just wondering... anyone else think having a script automatically kill gradle if it runs for more than X amount of minutes would be a great sanity saver?

"Jesus Fucking Zombie Christ I only added ONE FUCKING TEXTVIEW IN A SIMPLE GODDAMNED LINEAR LAYOUT YOU WORTHLESS MOTHERFUCKING PIECE OF SHIT AND GRADLE IS STILL RUNNING AFTER FIVE MOTHERFUCKING MINUTES?!?!?!?!?!!?!?!?!?!"

We have a customer that doesn't have a SINGLE linux admin. So now I have to fight with Docker EE on Windows Server 2019 (linux containers). Just fucking kill me already. Nothing works and when it does it just seems so shaky. Not like I didn't try to tell my team that linux containers on Docker EE for windows aren't officially supported and highly experimental.

But wtf do I expect from someone that STILL sells SAP and from someone that is stupid enough to buy it.

My worst team experience finished only a week ago:

- Be me
- be averaging 80% in completed modules and on track for a 1st
- have to take a team project worth double credits
- get stuck in random team with 40%ers
- lose 1 artist at the start (team of 12: 6 artists, 6 programmers)
- 2 artists contribute nothing and disappear for a few weeks
- I'm forced to do level design to have something to show (looked good tbh)
- weeks go by and too many contribute very little.
- by the end the team was basically 4 programmers and 2 artists contributing.

All other teams basically get an easy 2:1/1st just because their team turns up and contributes.

I could lose a 1st because of this module bringing down everything else, it also had a huge effect on what I could achieve for my dissertation due to time.

- did get an award at the end for managing to not kill someone and showing restraint 😂😂

Basically don't choose a degree where more than 25% of your mark is almost entirely out of your hands.

The small individual component I averaged over 90%!

"If you see a snake, just kill it. Don’t appoint a committee on snakes." - H. Ross Perot

FML I am an idiot.. might end up in a rant here (well deserved!!) //if you are here reading this I'm so sorry again!!

I wrote to our support I need DP/HDMI cable.. they asked me to take a pic of the cable I'm currently using.. WTF?! Don't you know how connectors look?! Just get me the damn cable.. :/
Ok.. Took a picture.. sent it back.. At that time I still didn't see the problem with what I wrote/demanded..
Got back reply this is not HDMI connector... FML, I was so convinced computer had HDMI ports so even when I took the pic I wasn't paying attention.. Fuck.

And before when I was switching cables behind the computer below desk I was just blindly feeling around, it didn't even occurr to me to actually check what connectors are used..just knew both monitors had the same connector (and not aure why I thought HDMI :/)...so yeah, I'm the idiot who is not paying attention to stuff.. Fuck.. Was on a scavanger hunt for a wrong type of cable the whole time.. Sorry again!! And please don't kill me next time you see me.. o.O

So, let me preface this by saying I come from a backend (mostly c#) background.

The way React handles objects changing in state is horrendous. And if you decide to try using hooks, God help you.

I honestly don't know if it's Blazor or something else that will kill js, but something absolutely needs to. It is a dumb, terrible language. It has to go.

All that said, of course I'll go back to work on it tomorrow.

Sorry, js/react guys/gals. Just venting. I'm sure once I 'get it', it will make sense.

(inspired by another rant I read here)

Last semester we were learning Java in the Programming Fundamentals class and a friend of mine asked for help with an assignment.

The objective was to make a virtual store (as a console app) in which the user would be able to select a few products, customize some of them and then the program would print out a receipt, with a list of all products, their prices, and the total cost.

Simple enough I thought, but there was a catch: you were not allowed to use arrays because the teacher hadn't taught that to the class yet. So I was like "how the fuck are you supposed to do this then?". Turns out the way to do it was to just append text to a string in order to generate the receipt. This is stupidly simple, so stupid that it didn't even cross my mind.

It's just that it's an awful way to architecture your code, it's just plain shit. Sure, if you're learning programming that's completely ok, but using that code on production is just completely unfeasible and I think that's why it didn't even cross my mind to do it this way. I'm just constantly worrying about performance and good code architecture and organization that the simplest of all solutions slipped my mind. When I finally discovered the way the teacher wanted us to do it I just wanted to kill myself...

The fuck is up with venv, conda, pip, pip3, python3, CRYPTOGRAPHY_OPENSSL_NO_LEGACY and "you can't install packages in docker based environments" DUDE STOP WHAT THE FUCK

How the fuck is that the scripting language of choice? It has by far the most confusing and messy runtime setup. Like it's easier to make sense of Javas version-shenanigans than this bullshit.

And then you think well what gives. Runs > python ...
"This environment is externally managed and you can go kill yourself, JUST LOOK UP PEP-666" LIKE NO YOU FUCK, JUST RUN THE FUCKING SCRIPT!

It's nice you thought about separation of versions but DOCKRR DOCKER DOCKER THERE ARE CONTAINERS WHY THE FUCK DO YOU DO SOME BULLSHIT WITH ENVS IN FOLDERS REQUIRING SOME RUNTIME BULLSHIT WHAT NO STOP WWHYYY

Asshole marketing director again.

We’ve just finished a bit of work with some marketing agency. They ran some ad campaigns for us, no biggie.

Anyway marketing director emails them, copies me in and asks them if the have any “tips on our approach to development”

AAAARGGGHHHH!!!!!?

WHAT THE FUCK?!

The things that happen when you don’t have a fucking meat cleaver in your hand. I swear this guy is the fucking King of Cunts. I could kill. I think the jail time might even be worth it!!

<warning>bad words</warning>

WHAT THE ACTUAL FUCK!!! LibreOffice Impress is a complete shit!! I am all about open source and such but this shit just sucks, moving elements around a frame snaps them to some grid, however when you paste an element from other frame it will have a different grid!!! This motherfucker has got an ALT function that will allow you to move the element more precisely but it only works seldom and it hates it when I try to use the fucking arrow keys - it even crashed once when I tried it. AND WHEN YOU FUCKING COPY A TABLE FROM ONE FUCKING FRAME TO ANOTHER MOTHERFUCKING FRAME, DELETE A FEW ROWS AND THEN COPY THE FREAKING TABLE BACK IT WILL HAVE MAGICALLY DIFFERENT DIMENSIONS BUT JUST EVER SO SLIGHTLY, BECAUSE FUCK THE USER, RIGHT??!!! (Doing this because there is no way to split tables into two different objects) I constantly have to save my presentation, kill the process and open it again because something just stops working or gets stuck, like seriously, WHAT THE ACTUAL FUCKING FUCK???!!! Are there no tests?!!! Do the people who work on this piece of motherfucking shit even use it???!!

has it ever happens to you that for whole day you kill yourself to solve error and next day you find out it was just happening because of a single semicolon

it hurts...